SimulationCraft 1026-01      berechnet von Metaux@Antonidas

for World of Warcraft 10.2.6.54205 Live (hotfix 2024-04-18/54205, git build b724d54dd3)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Baîr : 19231 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
19230.8 19230.8 14.4 / 0.075% 2875.1 / 15.0% 2228.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.1 Astral Power 0.00% 49.9 100.0% 100%
Origin https://worldofwarcraft.com/en-gb/character/antonidas/ba%C3%AEr
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgGJkkkIJSSAQSSCIpkgkElEFRSkDolIJREAoRBA
Scale Factors for Baîr Damage Per Second
Int SP Haste Mastery Vers Crit
Scale Factors 4.45 4.04 1.41 1.35 0.87 0.85
Normalized 1.00 0.91 0.32 0.30 0.20 0.19
Scale Deltas 595 595 595 595 595 595
Error 0.04 0.04 0.03 0.04 0.03 0.03
Ranking
  • Int > SP > Haste > Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=4.45, SpellPower=4.04, CritRating=0.85, HasteRating=1.41, MasteryRating=1.35, Versatility=0.87 )

Scale Factors for other metrics

Scale Factors for Baîr Priority Target Damage Per Second
Int SP Haste Mastery Vers Crit
Scale Factors 4.45 4.04 1.41 1.35 0.87 0.85
Normalized 1.00 0.91 0.32 0.30 0.20 0.19
Scale Deltas 595 595 595 595 595 595
Error 0.04 0.04 0.03 0.04 0.03 0.03
Ranking
  • Int > SP > Haste > Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=4.45, SpellPower=4.04, CritRating=0.85, HasteRating=1.41, MasteryRating=1.35, Versatility=0.87 )
Scale Factors for Baîr Damage Per Second (Effective)
Int SP Haste Mastery Vers Crit
Scale Factors 4.45 4.04 1.41 1.35 0.87 0.85
Normalized 1.00 0.91 0.32 0.30 0.20 0.19
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > SP > Haste > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=4.45, SpellPower=4.04, CritRating=0.85, HasteRating=1.41, MasteryRating=1.35, Versatility=0.87 )
Scale Factors for Baîr Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Baîr Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Baîr Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Baîr Damage Taken Per Second
Vers Haste Mastery Crit SP Int
Scale Factors -0.02 -0.01 -0.01 -0.00 -0.00 -0.00
Normalized 10.72 4.21 3.27 1.74 1.38 1.00
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Haste > Mastery > Crit > SP > Int
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=0.00, SpellPower=0.00, CritRating=0.00, HasteRating=0.01, MasteryRating=0.01, Versatility=0.02 )
Scale Factors for Baîr Damage Taken
Vers Haste Mastery Crit SP Int
Scale Factors -6.96 -2.59 -1.97 -1.05 -0.92 -0.56
Normalized 12.35 4.59 3.50 1.86 1.63 1.00
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Haste > Mastery > Crit > SP > Int
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=0.56, SpellPower=0.92, CritRating=1.05, HasteRating=2.59, MasteryRating=1.97, Versatility=6.96 )
Scale Factors for Baîr Healing Taken Per Second
Int SP Mastery Crit Vers Haste
Scale Factors 0.04 0.04 0.01 0.01 -0.00 -0.06
Normalized 1.00 0.96 0.24 0.19 -0.02 -1.45
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > SP > Mastery > Crit > Vers > Haste
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=0.04, SpellPower=0.04, CritRating=0.01, HasteRating=-0.06, MasteryRating=0.01, Versatility=-0.00 )
Scale Factors for Baîr Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for BaîrTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Baîr Fight Length
Int Vers Mastery SP Crit Haste
Scale Factors 0.00 0.00 0.00 0.00 0.00 -0.00
Normalized 1.00 0.50 0.50 0.50 0.01 -0.00
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > Vers > Mastery > SP > Crit > Haste
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=0.00, SpellPower=0.00, CritRating=0.00, HasteRating=-0.00, MasteryRating=0.00, Versatility=0.00 )
Scale Factors for Raid Damage Per Second
Int SP Haste Mastery Vers Crit
Scale Factors 4.45 4.04 1.41 1.35 0.87 0.85
Normalized 1.00 0.91 0.32 0.30 0.20 0.19
Scale Deltas 595 595 595 595 595 595
Error 0.04 0.04 0.03 0.04 0.03 0.03
Ranking
  • Int > SP > Haste > Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Baîr-Balance": Class=Druid, Spec=Balance, Intellect=4.45, SpellPower=4.04, CritRating=0.85, HasteRating=1.41, MasteryRating=1.35, Versatility=0.87 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Baîr 19231
Denizen of the Dream 0 (793) 0.0% (4.1%) 6.9 38.37s 34644 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 3902  / 793 4.1% 100.7 2.45s 2362 1475 Direct 100.1 2091 4184 2376 13.6%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.66 100.05 0.00 0.00 0.00 1.6013 0.0000 237722.07 237722.07 0.00% 1474.84 1474.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.38% 86.42 14 243 2090.88 1679 2830 2084.16 1870 2513 180700 180700 0.00%
crit 13.62% 13.63 1 46 4184.23 3358 5661 4168.42 3358 5661 57022 57022 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.521
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:21.42
Force of Nature 0 (333) 0.0% (1.7%) 5.4 60.99s 18473 15827

Stats Details: Force Of Nature

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.00 1.1674 0.0000 0.00 0.00 0.00% 15826.67 15826.67

Action Details: Force Of Nature

  • id:205636
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:20.0

Spelldata

  • id:205636
  • name:Force of Nature
  • school:nature
  • tooltip:Granting {$=}{{$s5=200}/10*{$d=0 milliseconds}} Astral Power over {$d=0 milliseconds}.
  • description:Summons a stand of {$s1=3} Treants for {$248280d=10 seconds} which immediately taunt and attack enemies in the targeted area. |cFFFFFFFFGenerates {$=}{{$m5=200}/10} Astral Power.|r

Action Priority List

    st
    [O]:5.39
  • if_expr:astral_power.deficit>variable.passive_asp+energize_amount

Affected By (Passive)

Type Spell ID # +/% Value
Spell RangeAstral Influence1975241ADD5.000
    melee 1880  / 333 1.7% 111.5 7.63s 893 692 Direct 111.5 784 1574 893 13.8%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.46 111.46 0.00 0.00 0.00 1.2917 0.0000 99565.61 142240.21 30.00% 691.59 691.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.17% 96.05 63 122 784.11 730 929 784.02 764 809 75310 107589 30.00%
crit 13.83% 15.41 2 31 1573.76 1459 1857 1573.93 1459 1791 24255 34651 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Moonfire 1816 9.4% 14.3 21.62s 37986 31526 Direct 14.3 1894 3894 2301 20.3%
Periodic 249.4 1685 3528 2050 19.8% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 249.44 249.44 13.31 1.2049 1.1956 544202.81 544202.81 0.00% 1724.90 31526.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 11.41 5 17 1894.04 1460 2730 1892.69 1704 2062 21616 21616 0.00%
crit 20.34% 2.91 0 10 3893.95 2920 5459 3756.44 0 5459 11347 11347 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.21% 200.07 147 256 1684.87 6 2375 1684.84 1622 1765 337094 337094 0.00%
crit 19.79% 49.37 24 84 3527.52 67 4750 3528.54 3249 3948 174145 174145 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [J]:2.43
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:11.90
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+energize_amount

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (1560) 0.0% (8.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 779 4.1% 73.1 4.06s 3194 0 Periodic 72.9 2382 4970 3202 31.7% 0.0%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.08 0.00 0.00 72.89 0.00 0.0000 0.0000 233424.54 233424.54 0.00% 0.00 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.31% 49.79 23 79 2382.32 1852 3434 2382.00 2206 2611 118623 118623 0.00%
crit 31.69% 23.10 7 41 4969.76 3674 6868 4970.51 4407 5632 114802 114802 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 782 4.1% 73.5 4.05s 3190 0 Periodic 73.3 2381 4962 3198 31.7% 0.0%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.47 0.00 0.00 73.28 0.00 0.0000 0.0000 234384.51 234384.51 0.00% 0.00 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.34% 50.08 23 85 2381.29 1837 3434 2380.78 2194 2604 119264 119264 0.00%
crit 31.66% 23.20 7 44 4962.33 3674 6868 4963.27 4429 5702 115121 115121 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 470 2.5% 23.7 11.35s 5985 3236 Direct 23.7 5264 10537 5985 13.7%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.67 23.67 0.00 0.00 0.00 1.8496 0.0000 141650.89 141650.89 0.00% 3236.03 3236.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.32% 20.43 8 30 5264.01 5003 6681 5257.29 5003 5603 107535 107535 0.00%
crit 13.68% 3.24 0 11 10537.16 10006 13363 10151.76 0 13363 34115 34115 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [M]:23.85
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Modified Effects

Effect Type Spell ID # +/% Value
Effect 3 ConditionalEclipse (Lunar)485182ADD30

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Umbral Embrace39376310.500Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Starsurge 5101 (7118) 26.5% (37.0%) 66.2 4.51s 32171 26326 Direct 66.1 (87.8) 17454 35753 23102 30.9% (31.6%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.23 66.10 0.00 0.00 0.00 1.2221 0.0000 1526915.19 1526915.19 0.00% 26325.94 26325.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.14% 45.70 27 65 17454.23 13039 24374 17455.64 16424 18642 797601 797601 0.00%
crit 30.86% 20.40 6 36 35752.52 30230 48748 35776.47 30986 41041 729314 729314 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:59.64
  • if_expr:variable.starsurge_condition1
    st
    [V]:6.59
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 2017 10.5% 21.8 13.48s 27700 0 Direct 21.7 20549 42145 27826 33.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.80 21.70 0.00 0.00 0.00 0.0000 0.0000 603932.94 603932.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.31% 14.39 3 30 20549.38 15271 28545 20549.23 17923 25713 295746 295746 0.00%
crit 33.69% 7.31 0 18 42145.39 35403 57091 42126.37 0 57091 308186 308186 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Damage on Debuff Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Stellar Flare 1313 6.8% 12.1 23.99s 32520 26391 Direct 13.1 1592 3174 1968 23.8%
Periodic 250.4 1145 2386 1468 26.0% 99.6%

Stats Details: Stellar Flare

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.09 13.09 250.40 250.40 11.23 1.2322 1.1935 393309.31 393309.31 0.00% 1253.54 26391.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.23% 9.98 3 16 1592.30 1171 2345 1591.89 1424 1880 15895 15895 0.00%
crit 23.77% 3.11 0 11 3174.41 2341 4691 3078.62 0 4691 9879 9879 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.97% 185.22 132 243 1144.79 1 1642 1144.95 1097 1204 212037 212037 0.00%
crit 26.03% 65.18 35 102 2385.68 2 3283 2386.47 2207 2589 155498 155498 0.00%

Action Details: Stellar Flare

  • id:202347
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.098000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:24.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering {$=}w2 Astral damage every {$t2=2} sec. If dispelled, will cause {$356474s1=0} damage to the dispeller and blast them upwards.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional {$=}o2 damage over {$d=24 seconds}. If dispelled, causes {$356474s1=0} damage to the dispeller and blasts them upwards. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [K]:1.63
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+energize_amount&remains<2&(target.time_to_die-remains)>8
    st
    [T]:10.51
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+energize_amount

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Sunfire 1841 9.6% 17.4 18.07s 31756 26571 Direct 17.4 1852 3742 2393 28.6%
Periodic 250.4 1640 3327 2038 23.6% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 250.44 250.44 16.38 1.1952 1.1953 551880.10 551880.10 0.00% 1723.93 26571.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.37% 12.40 4 20 1851.68 1394 2481 1850.03 1683 2021 22966 22966 0.00%
crit 28.63% 4.98 0 14 3742.25 2788 4963 3729.95 0 4963 18621 18621 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 76.41% 191.37 137 247 1639.51 271 2159 1639.02 1577 1710 313749 313749 0.00%
crit 23.59% 59.07 32 89 3327.04 1763 4318 3326.27 3116 3537 196544 196544 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=false}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=false}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [I]:3.61
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:13.77
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+energize_amount

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Sunfire16481540.283Mastery
Waning Twilight39395710.100
Wrath 3987 20.7% 100.1 3.00s 11925 10323 Direct 99.7 9717 20006 11974 21.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.13 99.72 0.00 0.00 0.00 1.1553 0.0000 1193996.92 1193996.92 0.00% 10322.53 10322.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.06% 77.84 51 104 9716.60 3844 19519 9716.64 8695 11026 756376 756376 0.00%
crit 21.94% 21.87 7 40 20005.64 7688 39039 20005.82 15353 26463 437621 437621 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:8.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [N]:2.06
  • if_expr:variable.enter_eclipse
    st
    [W]:96.40

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Modified Effects

Effect Type Spell ID # +/% Value
Effect 2 PermanentAstral Power1979112ADD80
ConditionalEclipse (Solar)485175PCT0

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.600Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Umbral Embrace39376310.500Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Damage on Debuff Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Baîr
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.45s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [L]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.37s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Details: Natures Vigil Tick

  • id:124991
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:60.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baîr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00

Spelldata

  • id:124991
  • name:Nature's Vigil
  • school:nature
  • tooltip:
  • description:{$@spelldesc124974=For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].}

Action Priority List

    default
    [E]:3.74
  • if_expr:active_enemies
Elemental Potion of Ultimate Power 1.5 307.04s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 6.0 2.2 52.8s 42.3s 8.6s 17.15% 19.35% 2.2 (13.9) 5.8

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.1s / 89.0s
  • trigger_min/max:0.0s / 86.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:14.29% / 24.46%

Stack Uptimes

  • balance_of_all_things_arcane_1:1.95%
  • balance_of_all_things_arcane_2:1.96%
  • balance_of_all_things_arcane_3:1.97%
  • balance_of_all_things_arcane_4:2.02%
  • balance_of_all_things_arcane_5:2.06%
  • balance_of_all_things_arcane_6:2.18%
  • balance_of_all_things_arcane_7:2.49%
  • balance_of_all_things_arcane_8:2.53%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 16.6 1.1 18.5s 17.3s 8.3s 46.00% 50.27% 1.1 (2.0) 16.1

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 44.9s
  • trigger_min/max:3.7s / 37.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:39.38% / 49.44%

Stack Uptimes

  • balance_of_all_things_nature_1:5.51%
  • balance_of_all_things_nature_2:5.61%
  • balance_of_all_things_nature_3:5.70%
  • balance_of_all_things_nature_4:5.78%
  • balance_of_all_things_nature_5:5.82%
  • balance_of_all_things_nature_6:5.84%
  • balance_of_all_things_nature_7:5.86%
  • balance_of_all_things_nature_8:5.88%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.3s 49.9s 80.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 297.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.8s
  • uptime_min/max:50.44% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.07%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 6.9 0.0 48.9s 38.7s 38.5s 49.29% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 253.3s
  • trigger_min/max:0.0s / 182.8s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 223.8s
  • uptime_min/max:12.42% / 94.85%

Stack Uptimes

  • denizen_of_the_dream_1:36.08%
  • denizen_of_the_dream_2:10.76%
  • denizen_of_the_dream_3:2.12%
  • denizen_of_the_dream_4:0.29%
  • denizen_of_the_dream_5:0.04%
  • denizen_of_the_dream_6:0.00%
  • denizen_of_the_dream_7:0.02%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Lunar) 5.0 2.2 65.2s 49.7s 22.2s 37.02% 39.97% 2.2 (2.2) 4.7

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 96.0s
  • trigger_min/max:0.0s / 96.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.8s
  • uptime_min/max:31.37% / 46.07%

Stack Uptimes

  • eclipse_lunar_1:37.02%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 14.0 2.7 22.1s 18.4s 18.7s 87.47% 91.17% 2.7 (2.7) 13.2

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 59.5s
  • trigger_min/max:3.7s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.6s
  • uptime_min/max:81.29% / 90.44%

Stack Uptimes

  • eclipse_solar_1:87.47%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.3s 307.3s 27.3s 13.22% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.5s
  • trigger_min/max:300.0s / 329.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.90% / 18.05%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.22%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 4.6 2.2 61.0s 38.7s 23.7s 36.68% 36.72% 2.2 (2.2) 4.3

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 205.1s
  • trigger_min/max:0.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 136.2s
  • uptime_min/max:8.52% / 79.55%

Stack Uptimes

  • friend_of_the_fae_1:36.68%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 5.0 0.0 65.0s 65.0s 21.4s 35.52% 39.14% 0.0 (0.0) 4.7

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 96.0s
  • trigger_min/max:12.0s / 96.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.0s
  • uptime_min/max:30.73% / 40.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:35.52%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Nature's Grace 15.2 0.0 20.4s 20.3s 5.9s 29.96% 0.00% 0.0 (0.0) 14.8

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 48.0s
  • trigger_min/max:0.0s / 42.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:26.62% / 32.42%

Stack Uptimes

  • natures_grace_1:29.96%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.53% / 21.02%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Primordial Arcanic Pulsar 4.9 62.3 66.8s 66.8s 58.1s 94.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:44.1s / 84.0s
  • trigger_min/max:44.1s / 84.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.7s
  • uptime_min/max:90.44% / 97.48%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.64%
  • primordial_arcanic_pulsar_8:7.81%
  • primordial_arcanic_pulsar_12:5.27%
  • primordial_arcanic_pulsar_16:7.42%
  • primordial_arcanic_pulsar_20:8.97%
  • primordial_arcanic_pulsar_24:5.49%
  • primordial_arcanic_pulsar_28:5.60%
  • primordial_arcanic_pulsar_32:9.17%
  • primordial_arcanic_pulsar_36:7.46%
  • primordial_arcanic_pulsar_40:5.87%
  • primordial_arcanic_pulsar_44:6.51%
  • primordial_arcanic_pulsar_48:6.28%
  • primordial_arcanic_pulsar_52:6.96%
  • primordial_arcanic_pulsar_56:5.68%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 17.5 2.4 17.7s 16.1s 6.2s 36.34% 35.92% 2.4 (2.4) 17.1

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 37.1s
  • trigger_min/max:0.0s / 37.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.20% / 38.37%

Stack Uptimes

  • solstice_1:36.34%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 19.1 47.1 15.9s 4.5s 14.4s 91.95% 0.00% 9.7 (9.7) 13.9

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 21.7s
  • trigger_min/max:0.9s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:87.03% / 96.05%

Stack Uptimes

  • starlord_1:17.68%
  • starlord_2:25.46%
  • starlord_3:48.81%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 18.2 2.7 16.1s 13.9s 2.8s 16.74% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 64.2s
  • trigger_min/max:0.0s / 64.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s
  • uptime_min/max:4.20% / 35.17%

Stack Uptimes

  • umbral_embrace_1:16.74%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Winds of Ohn'ahra 2.0 0.0 159.3s 159.3s 9.9s 6.52% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_winds_of_ohnahra
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Ohn'ahra's Carving

Stat Details

  • stat:haste_rating
  • amount:147.87

Trigger Details

  • interval_min/max:120.0s / 315.0s
  • trigger_min/max:120.0s / 315.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:2.79% / 11.50%

Stack Uptimes

  • winds_of_ohnahra_1:6.52%

Spelldata

  • id:381998
  • name:Winds of Ohn'ahra
  • tooltip:Ohn'ahra's winds increase your Haste by {$=}w1.
  • description:{$@spelldesc381996=Your damaging attacks and abilities have a chance for Ohn'ahra to bless you with her winds, increasing your Haste by {$381998s1=272}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 6.9 2.0 18.0 38.7s 0.0s 182.8s
Primordial Arcanic Pulsar 3.9 3.0 5.0 72.8s 62.3s 86.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 1.28% 0.5s 0.0s 3.3s
Incarnation (Total) 35.52% 30.73% 40.00% 21.4s 0.0s 42.0s
Incarnation (Pulsar) 15.25% 13.19% 17.66% 11.7s 0.0s 12.0s
Lunar Eclipse Only 1.50% 0.62% 7.96% 2.0s 0.0s 15.0s
Solar Eclipse Only 51.94% 43.22% 57.82% 13.3s 0.0s 15.0s
No Eclipse 10.96% 8.00% 13.37% 2.5s 0.0s 5.2s
Friend of the Fae 36.68% 8.52% 79.55% 23.7s 0.0s 136.2s

Eclipse Utilization

NoneSolarLunarBoth
Wrath2.522.6%47.4848.4%0.660.7%47.4748.4%
Starfire23.67100.0%0.000.0%0.000.0%0.000.0%
Starsurge0.000.0%35.8954.2%0.500.7%29.8545.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Baîr
Nature's BalanceAstral Power98.99197.908.12%2.000.090.05%
Force of NatureAstral Power5.39107.794.42%20.000.000.00%
MoonfireAstral Power14.3385.893.52%6.000.060.07%
Shooting Stars (Moonfire)Astral Power73.08146.085.99%2.000.090.06%
Shooting Stars (Sunfire)Astral Power73.47146.856.02%2.000.090.06%
StarfireAstral Power23.67235.479.66%9.951.190.50%
Stellar FlareAstral Power13.09157.136.45%12.000.000.00%
SunfireAstral Power17.38104.214.27%6.000.060.06%
WrathAstral Power100.131256.6651.55%12.550.080.01%
Usage Type Count Total Tot% Avg RPE APR
Baîr
StarsurgeAstral Power 66.232434.14100.00%36.7536.75875.40
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 172320.0 379.27 547.54 131941.6 121841.4 -97720.3 172320.0
Astral Power 78.0 8.13 8.11 1.7 25.8 0.0 100.0

Statistics & Data Analysis

Fight Length
Baîr Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Baîr Damage Per Second
Count 9999
Mean 19230.79
Minimum 16804.86
Maximum 22585.62
Spread ( max - min ) 5780.75
Range [ ( max - min ) / 2 * 100% ] 15.03%
Standard Deviation 733.2290
5th Percentile 18086.27
95th Percentile 20485.87
( 95th Percentile - 5th Percentile ) 2399.61
Mean Distribution
Standard Deviation 7.3327
95.00% Confidence Interval ( 19216.42 - 19245.16 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5585
0.1 Scale Factor Error with Delta=300 4590
0.05 Scale Factor Error with Delta=300 18358
0.01 Scale Factor Error with Delta=300 458948
Priority Target DPS
Baîr Priority Target Damage Per Second
Count 9999
Mean 19230.79
Minimum 16804.86
Maximum 22585.62
Spread ( max - min ) 5780.75
Range [ ( max - min ) / 2 * 100% ] 15.03%
Standard Deviation 733.2290
5th Percentile 18086.27
95th Percentile 20485.87
( 95th Percentile - 5th Percentile ) 2399.61
Mean Distribution
Standard Deviation 7.3327
95.00% Confidence Interval ( 19216.42 - 19245.16 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5585
0.1 Scale Factor Error with Delta=300 4590
0.05 Scale Factor Error with Delta=300 18358
0.01 Scale Factor Error with Delta=300 458948
DPS(e)
Baîr Damage Per Second (Effective)
Count 9999
Mean 19230.79
Minimum 16804.86
Maximum 22585.62
Spread ( max - min ) 5780.75
Range [ ( max - min ) / 2 * 100% ] 15.03%
Damage
Baîr Damage
Count 9999
Mean 5423697.21
Minimum 4028713.12
Maximum 6885118.76
Spread ( max - min ) 2856405.64
Range [ ( max - min ) / 2 * 100% ] 26.33%
DTPS
Baîr Damage Taken Per Second
Count 9999
Mean 547.64
Minimum 0.00
Maximum 1359.23
Spread ( max - min ) 1359.23
Range [ ( max - min ) / 2 * 100% ] 124.10%
HPS
Baîr Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Baîr Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Baîr Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Baîr Healing Taken Per Second
Count 9999
Mean 378.13
Minimum 0.00
Maximum 732.08
Spread ( max - min ) 732.08
Range [ ( max - min ) / 2 * 100% ] 96.80%
TMI
Baîr Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaîrTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Baîr Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
E 3.74 natures_vigil,if=active_enemies
0.00 invoke_external_buff,name=power_infusion
F 0.00 run_action_list,name=aoe,if=variable.is_aoe
G 0.00 run_action_list,name=st
actions.st
# count action,conditions
I 3.61 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
J 2.43 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
K 1.63 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
0.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
L 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
M 23.85 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
N 2.06 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+energize_amount
O 5.39 force_of_nature,if=astral_power.deficit>variable.passive_asp+energize_amount
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
P 0.17 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 59.64 starsurge,if=variable.starsurge_condition1
R 13.77 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
S 11.90 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
T 10.51 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|buff.ca_inc.up&cooldown.full_moon.ready&astral_power.deficit+variable.passive_asp<action.full_moon.energize_amount|fight_remains<5
U 4.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
V 6.59 starsurge,if=variable.starsurge_condition2
W 96.40 wrath
X 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ABEIJLDOQQWQWWQWWWWRWVWWUQQSQTWWWWWVWWVVMMQIWWQSWTQWWWWRNNQQWQWWWSOMMUQQRKQWWWWVWMMQRJQETWQWWWMMQRQSWWQWWTWMMQQORQSWQWWWWWMMQQIKQWWSWVWMMQRWQTWQWWWMMQJRQEWWLOQQTWWWQQRSWWQWWQWWWQQWTQRWSWWWWUQQMMQWRWQWTWQSWMMOQQRWWQWWQTSNNQWRWWQEWWQWQWWWMMRJQKQWQWWWMM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Baîr 50.0/100: 50% astral_power
Pre precombat 1 food Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Baîr 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 58.0/100: 58% astral_power corrupting_rage
Pre precombat B stellar_flare Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default E natures_vigil Baîr 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 st I sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:01.111 st J moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.222 st L incarnation_chosen_of_elune Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.222 default D potion Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, corrupting_rage
0:02.222 st O force_of_nature Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, corrupting_rage, elemental_potion_of_ultimate_power
0:03.142 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, corrupting_rage, elemental_potion_of_ultimate_power
0:04.064 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord, corrupting_rage, elemental_potion_of_ultimate_power
0:04.947 st W wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.799 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.652 st W wrath Fluffy_Pillow 10.8/100: 11% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:07.473 st W wrath Fluffy_Pillow 27.6/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:08.294 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:09.197 st W wrath Fluffy_Pillow 10.4/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:10.101 st W wrath Fluffy_Pillow 23.2/100: 23% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:11.004 st W wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:11.906 st W wrath Fluffy_Pillow 52.8/100: 53% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:12.807 st R sunfire Fluffy_Pillow 67.6/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:13.709 st W wrath Fluffy_Pillow 75.6/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:14.612 st V starsurge Fluffy_Pillow 90.4/100: 90% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:15.515 st W wrath Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:16.416 st W wrath Fluffy_Pillow 73.2/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:17.317 st U cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:17.317 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), corrupting_rage, elemental_potion_of_ultimate_power
0:18.326 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord, corrupting_rage, elemental_potion_of_ultimate_power
0:19.298 st S moonfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:20.235 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:21.172 st T stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:22.075 st W wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:22.977 st W wrath Fluffy_Pillow 30.8/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.880 st W wrath Fluffy_Pillow 43.6/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.782 st W wrath Fluffy_Pillow 56.4/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.684 st W wrath Fluffy_Pillow 73.2/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.587 st V starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.488 st W wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.390 st W wrath Fluffy_Pillow 70.8/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.292 st V starsurge Fluffy_Pillow 85.6/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.195 st V starsurge Fluffy_Pillow 55.6/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.098 st M starfire Fluffy_Pillow 23.6/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.451 st M starfire Fluffy_Pillow 35.6/100: 36% astral_power bloodlust, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), corrupting_rage
0:33.965 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power bloodlust, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, corrupting_rage
0:34.974 st I sunfire Fluffy_Pillow 11.6/100: 12% astral_power bloodlust, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
0:35.947 st W wrath Fluffy_Pillow 19.6/100: 20% astral_power bloodlust, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
0:36.920 st W wrath Fluffy_Pillow 32.4/100: 32% astral_power bloodlust, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
0:37.892 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power bloodlust, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
0:38.864 st S moonfire Fluffy_Pillow 13.2/100: 13% astral_power bloodlust, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(2), corrupting_rage
0:39.894 st W wrath Fluffy_Pillow 19.2/100: 19% astral_power bloodlust, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(2), corrupting_rage
0:40.924 st T stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), corrupting_rage
0:42.261 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), corrupting_rage
0:43.600 st W wrath Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
0:44.890 st W wrath Fluffy_Pillow 22.8/100: 23% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
0:46.180 st W wrath Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
0:47.468 st W wrath Fluffy_Pillow 52.4/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
0:48.757 st R sunfire Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), winds_of_ohnahra, corrupting_rage
0:50.036 st N wrath Fluffy_Pillow 75.2/100: 75% astral_power natures_grace, primordial_arcanic_pulsar(56), winds_of_ohnahra, corrupting_rage
0:51.338 st N wrath Fluffy_Pillow 85.2/100: 85% astral_power natures_grace, primordial_arcanic_pulsar(56), winds_of_ohnahra, corrupting_rage
0:52.639 st Q starsurge Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(8), eclipse_lunar, natures_grace, primordial_arcanic_pulsar(56), solstice, winds_of_ohnahra, corrupting_rage
0:53.940 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, winds_of_ohnahra, corrupting_rage
0:55.079 st W wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), winds_of_ohnahra, corrupting_rage
0:56.284 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), winds_of_ohnahra
0:57.489 st W wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), winds_of_ohnahra
0:58.652 st W wrath Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), winds_of_ohnahra
0:59.814 st W wrath Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3)
1:00.987 st S moonfire Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3)
1:02.158 st O force_of_nature Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), umbral_embrace
1:03.396 st M starfire Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), umbral_embrace
1:05.153 st M starfire Fluffy_Pillow 98.4/100: 98% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), starlord(3), umbral_embrace
1:06.911 st U cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), umbral_embrace
1:06.911 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, umbral_embrace
1:08.224 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord, umbral_embrace
1:09.485 st R sunfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), umbral_embrace
1:10.702 st K stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(2), umbral_embrace
1:12.039 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(2), umbral_embrace, corrupting_rage
1:13.376 st W wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), umbral_embrace, corrupting_rage
1:14.666 st W wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
1:15.954 st W wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
1:17.243 st W wrath Fluffy_Pillow 54.4/100: 54% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
1:18.536 st V starsurge Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
1:19.826 st W wrath Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage
1:21.113 st M starfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage
1:23.046 st M starfire Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), corrupting_rage
1:25.013 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, corrupting_rage
1:26.325 st R sunfire Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, corrupting_rage
1:27.588 st J moonfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, corrupting_rage
1:28.851 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, corrupting_rage
1:30.240 default E natures_vigil Baîr 12.0/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(2), corrupting_rage
1:30.240 st T stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(2), corrupting_rage
1:31.576 st W wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), corrupting_rage
1:32.913 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), corrupting_rage
1:34.250 st W wrath Fluffy_Pillow 4.8/100: 5% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), umbral_embrace, corrupting_rage
1:35.540 st W wrath Fluffy_Pillow 19.6/100: 20% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage
1:36.830 st W wrath Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage
1:38.120 st M starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), corrupting_rage
1:40.054 st M starfire Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), corrupting_rage
1:42.021 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, corrupting_rage
1:43.335 st R sunfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, corrupting_rage
1:44.601 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, corrupting_rage
1:45.862 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), corrupting_rage
1:47.077 st W wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(2), corrupting_rage
1:48.416 st W wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), corrupting_rage
1:49.753 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), corrupting_rage
1:51.089 st W wrath Fluffy_Pillow 10.8/100: 11% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
1:52.379 st W wrath Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
1:53.668 st T stellar_flare Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
1:54.959 st W wrath Fluffy_Pillow 54.4/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
1:56.248 st M starfire Fluffy_Pillow 71.2/100: 71% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
1:58.182 st M starfire Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(48), corrupting_rage
2:00.147 st Q starsurge Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, corrupting_rage
2:01.459 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, corrupting_rage
2:02.721 st O force_of_nature Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), corrupting_rage
2:03.936 st R sunfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), corrupting_rage
2:05.274 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), corrupting_rage
2:06.613 st S moonfire Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), corrupting_rage
2:07.787 st W wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), umbral_embrace, corrupting_rage
2:08.960 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), corrupting_rage
2:10.132 st W wrath Fluffy_Pillow 0.0/100: 0% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), corrupting_rage
2:11.303 st W wrath Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), corrupting_rage
2:12.477 st W wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), corrupting_rage
2:13.651 st W wrath Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), corrupting_rage
2:14.823 st W wrath Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), corrupting_rage
2:15.994 st M starfire Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), corrupting_rage
2:17.962 st M starfire Fluffy_Pillow 88.0/100: 88% astral_power natures_grace, primordial_arcanic_pulsar(4), corrupting_rage
2:19.930 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, corrupting_rage
2:21.243 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord, corrupting_rage
2:22.504 st I sunfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(2), corrupting_rage
2:23.721 st K stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), corrupting_rage
2:25.058 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), corrupting_rage
2:26.395 st W wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
2:27.685 st W wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
2:28.974 st S moonfire Fluffy_Pillow 43.6/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
2:30.262 st W wrath Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
2:31.550 st V starsurge Fluffy_Pillow 64.4/100: 64% astral_power eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
2:32.839 st W wrath Fluffy_Pillow 24.4/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
2:34.129 st M starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
2:36.061 st M starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(20), corrupting_rage
2:38.029 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, umbral_embrace, corrupting_rage
2:39.341 st R sunfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, umbral_embrace, corrupting_rage
2:40.605 st W wrath Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, umbral_embrace, corrupting_rage
2:41.867 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord, corrupting_rage
2:43.258 st T stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), corrupting_rage
2:44.594 st W wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), corrupting_rage
2:45.932 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), corrupting_rage
2:47.270 st W wrath Fluffy_Pillow 4.8/100: 5% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), umbral_embrace, corrupting_rage
2:48.560 st W wrath Fluffy_Pillow 17.6/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage
2:49.850 st W wrath Fluffy_Pillow 32.4/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage
2:51.139 st M starfire Fluffy_Pillow 45.2/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage
2:53.070 st M starfire Fluffy_Pillow 57.2/100: 57% astral_power natures_grace, primordial_arcanic_pulsar(32), corrupting_rage
2:55.039 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, winds_of_ohnahra
2:56.341 st J moonfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, winds_of_ohnahra
2:57.592 st R sunfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, winds_of_ohnahra
2:58.845 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, winds_of_ohnahra
3:00.099 default E natures_vigil Baîr 11.2/100: 11% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), winds_of_ohnahra
3:00.240 st W wrath Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), winds_of_ohnahra
3:01.566 st W wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), winds_of_ohnahra
3:02.891 st L incarnation_chosen_of_elune Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), winds_of_ohnahra
3:02.891 st O force_of_nature Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), winds_of_ohnahra
3:03.986 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), winds_of_ohnahra
3:05.082 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3)
3:06.149 st T stellar_flare Fluffy_Pillow 2.8/100: 3% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3)
3:07.216 st W wrath Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3)
3:08.283 st W wrath Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3)
3:09.350 st W wrath Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage
3:10.523 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), corrupting_rage
3:11.836 st Q starsurge Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord, corrupting_rage
3:13.098 st R sunfire Fluffy_Pillow 1.2/100: 1% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), corrupting_rage
3:14.312 st S moonfire Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), corrupting_rage
3:15.528 st W wrath Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), umbral_embrace, corrupting_rage
3:16.745 st W wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), corrupting_rage
3:17.961 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), corrupting_rage
3:19.176 st W wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), corrupting_rage
3:20.348 st W wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), corrupting_rage
3:21.520 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), corrupting_rage
3:22.692 st W wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), corrupting_rage
3:23.863 st W wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), corrupting_rage
3:25.037 st W wrath Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), corrupting_rage
3:26.211 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), corrupting_rage
3:27.523 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, corrupting_rage
3:28.786 st W wrath Fluffy_Pillow 4.8/100: 5% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), corrupting_rage
3:30.002 st T stellar_flare Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), corrupting_rage
3:31.217 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), corrupting_rage
3:32.430 st R sunfire Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:33.604 st W wrath Fluffy_Pillow 11.6/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:34.777 st S moonfire Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:35.950 st W wrath Fluffy_Pillow 32.4/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:37.124 st W wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:38.296 st W wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:39.467 st W wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:40.638 st U cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), corrupting_rage
3:40.638 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), corrupting_rage
3:41.951 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord, corrupting_rage
3:43.214 st M starfire Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(2), umbral_embrace, corrupting_rage
3:45.036 st M starfire Fluffy_Pillow 35.6/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(2), umbral_embrace, corrupting_rage
3:46.857 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), umbral_embrace, corrupting_rage
3:48.073 st W wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), umbral_embrace, corrupting_rage
3:49.245 st R sunfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), corrupting_rage
3:50.417 st W wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), corrupting_rage
3:51.589 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), corrupting_rage
3:52.878 st W wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage
3:54.165 st T stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage
3:55.455 st W wrath Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), umbral_embrace, corrupting_rage
3:56.745 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), corrupting_rage
3:58.190 st S moonfire Fluffy_Pillow 14.8/100: 15% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, corrupting_rage
3:59.580 st W wrath Fluffy_Pillow 22.8/100: 23% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, corrupting_rage
4:00.969 st M starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, corrupting_rage
4:03.049 st M starfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord, corrupting_rage
4:04.941 st O force_of_nature Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, corrupting_rage
4:06.204 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, corrupting_rage
4:07.467 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), corrupting_rage
4:08.682 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), corrupting_rage
4:09.972 st W wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), umbral_embrace, corrupting_rage
4:11.263 st W wrath Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3)
4:12.552 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44)
4:13.995 st W wrath Fluffy_Pillow 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord
4:15.383 st W wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord
4:16.771 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord
4:18.158 st T stellar_flare Fluffy_Pillow 2.8/100: 3% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2)
4:19.495 st S moonfire Fluffy_Pillow 16.8/100: 17% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2)
4:20.832 st N wrath Fluffy_Pillow 24.8/100: 25% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(2)
4:22.049 st N wrath Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(2)
4:23.264 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(8), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2)
4:24.480 st W wrath Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(7), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3)
4:25.653 st R sunfire Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(6), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), corrupting_rage
4:26.825 st W wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(5), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), corrupting_rage
4:28.113 st W wrath Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(4), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, corrupting_rage
4:29.555 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(2), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, primordial_arcanic_pulsar(56), corrupting_rage
4:30.998 default E natures_vigil Baîr 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, corrupting_rage
4:30.998 st W wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, corrupting_rage
4:32.261 st W wrath Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, corrupting_rage
4:33.525 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, corrupting_rage
4:34.787 st W wrath Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), corrupting_rage
4:36.002 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(2), corrupting_rage
4:37.216 st W wrath Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), corrupting_rage
4:38.388 st W wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), corrupting_rage
4:39.559 st W wrath Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), corrupting_rage
4:40.732 st M starfire Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), corrupting_rage
4:42.486 st M starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(8), starlord(3), umbral_embrace, corrupting_rage
4:44.244 st R sunfire Fluffy_Pillow 71.6/100: 72% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), umbral_embrace, corrupting_rage
4:45.416 st J moonfire Fluffy_Pillow 79.6/100: 80% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, umbral_embrace, corrupting_rage
4:46.728 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, umbral_embrace, corrupting_rage
4:48.041 st K stellar_flare Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord, umbral_embrace, corrupting_rage
4:49.428 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord, umbral_embrace, corrupting_rage
4:50.816 st W wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), umbral_embrace, corrupting_rage
4:52.154 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), corrupting_rage
4:53.494 st W wrath Fluffy_Pillow 4.4/100: 4% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
4:54.784 st W wrath Fluffy_Pillow 17.2/100: 17% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
4:56.075 st W wrath Fluffy_Pillow 36.0/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
4:57.365 st M starfire Fluffy_Pillow 48.8/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage
4:59.297 st M starfire Fluffy_Pillow 62.8/100: 63% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 8616 8206 4358
Intellect 2089 0 4564 4177 1890 (1088)
Spirit 0 0 0 0 0
Health 172320 164120 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 4564 4177 0
Crit 14.87% 8.66% 658
Haste 4.18% 4.18% 536
Versatility 7.70% 2.70% 553
Mana Regen 2560 2560 0
Mastery 7.81% 7.81% 903
Armor 954 954 954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 287.00
Local Head Teerai Watcher Hood
ilevel: 276, stats: { 103 Armor, +378 Sta, +79 Haste, +94 Mastery, +129 AgiInt }
Local Shoulders Field Scout's Spaulders
ilevel: 272, stats: { 92 Armor, +268 Sta, +69 Crit, +58 Mastery, +93 AgiInt }
Local Shirt Precious' Ribbon
ilevel: 1
item effects: { equip: }
Local Chest Pioneer's Leather Tunic
ilevel: 312, stats: { 181 Armor, +588 Sta, +103 Mastery, +103 Vers, +180 AgiInt }
Local Waist Ottuk Hide Sash
ilevel: 316, stats: { 116 Armor, +449 Sta, +94 Crit, +79 Mastery, +140 AgiInt }
Local Legs Teerai Watcher Breeches
ilevel: 272, stats: { 117 Armor, +358 Sta, +88 Crit, +81 Mastery, +124 AgiInt }
Local Feet Pioneer's Leather Boots
ilevel: 312, stats: { 113 Armor, +441 Sta, +77 Mastery, +77 Crit, +135 AgiInt }
Local Wrists Pioneer's Leather Wristguards
ilevel: 312, stats: { 91 Armor, +331 Sta, +58 Haste, +58 Mastery, +101 AgiInt }
Local Hands Teerai Watcher Gloves
ilevel: 289, stats: { 84 Armor, +335 Sta, +72 Crit, +66 Vers, +109 AgiInt }
Local Finger1 Roscha's Band of Remembrance
ilevel: 289, stats: { +251 Sta, +135 Haste, +179 Vers }
Local Finger2 Ring of Embers
ilevel: 246, stats: { +142 Sta, +135 Crit, +101 Haste }
Local Trinket1 Lifegift Ruby
ilevel: 246, stats: { +106 Vers }
item effects: { equip: Gift of Life }
Local Trinket2 Ohn'ahra's Carving
ilevel: 276, stats: { +123 Crit }
item effects: { equip: Winds of Ohn'ahra }
Local Back Drape of the Djaradin Slayer
ilevel: 282, stats: { 57 Armor, +229 Sta, +56 Haste, +43 Mastery, +77 StrAgiInt }
Local Main Hand Staff of the Windsage
ilevel: 312, weapon: { 207 - 282, 3.6 }, stats: { +180 Int, +622 Int, +588 Sta, +107 Haste, +99 Vers }, temporary_enchant: Hissing Rune

Profile

druid="Baîr"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/ba%C3%AEr"
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgGJkkkIJSSAQSSCIpkgkElEFRSkDolIJREAoRBA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil,if=active_enemies
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+energize_amount,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+energize_amount
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+energize_amount,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+energize_amount&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+energize_amount&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+energize_amount
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+energize_amount
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/wild_mushroom,if=!variable.is_aoe
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+energize_amount
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+energize_amount
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+energize_amount
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|buff.ca_inc.up&cooldown.full_moon.ready&astral_power.deficit+variable.passive_asp<action.full_moon.energize_amount|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=teerai_watcher_hood,id=197648,bonus_id=7963,drop_level=65
shoulders=field_scouts_spaulders,id=194354,bonus_id=8774/8775,drop_level=62
back=drape_of_the_djaradin_slayer,id=194370,bonus_id=8771/8773,drop_level=62
chest=pioneers_leather_tunic,id=193390,bonus_id=8837/8838/4785/9403,crafted_stats=mastery/vers
shirt=precious_ribbon,id=52019
wrists=pioneers_leather_wristguards,id=193388,bonus_id=8837/8838/4785/9403/9415,crafted_stats=haste/mastery
hands=teerai_watcher_gloves,id=197642,bonus_id=7963/7964,drop_level=65
waist=ottuk_hide_sash,id=191995,bonus_id=9156/6652/7937,drop_level=69
legs=teerai_watcher_breeches,id=197652,bonus_id=8768,drop_level=65
feet=pioneers_leather_boots,id=193386,bonus_id=8837/8838/4785/9403,crafted_stats=mastery/crit
finger1=roschas_band_of_remembrance,id=197668,bonus_id=7963/7964,drop_level=65
finger2=ring_of_embers,id=200163,bonus_id=9156/6652/7937,drop_level=62
trinket1=lifegift_ruby,id=194399,bonus_id=7963,drop_level=62
trinket2=ohnahras_carving,id=197846,bonus_id=7963,drop_level=65
main_hand=staff_of_the_windsage,id=197690,bonus_id=8778/8779,drop_level=65

# Gear Summary
# gear_ilvl=286.57
# gear_stamina=4358
# gear_intellect=1890
# gear_crit_rating=658
# gear_haste_rating=536
# gear_mastery_rating=903
# gear_versatility_rating=553
# gear_armor=954

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 65624316
Max Event Queue: 69
Sim Seconds: 3002020
CPU Seconds: 37.6304
Physical Seconds: 18.3255
Speed Up: 79776

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Baîr Baîr augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Baîr Baîr denizen_of_the_dream 394065 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 38.37sec 0 299.99sec
Baîr Baîr_Denizen of the Dream fey_missile 188046 237722 6056 152.92 2091 4184 100.7 100.1 13.6% 0.0% 0.0% 0.0% 2.45sec 237722 39.26sec
Baîr Baîr flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Baîr Baîr food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Baîr Baîr force_of_nature 205636 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.99sec 0 299.99sec
Baîr Baîr_Treant melee 0 99566 1876 126.03 784 1574 111.5 111.5 13.8% 0.0% 0.0% 0.0% 7.63sec 142240 53.06sec
Baîr Baîr incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.45sec 0 299.99sec
Baîr Baîr moonfire 8921 32963 110 2.87 1894 3894 14.3 14.3 20.3% 0.0% 0.0% 0.0% 21.62sec 544203 299.99sec
Baîr Baîr moonfire ticks -8921 511240 1704 49.89 1685 3528 14.3 249.4 19.8% 0.0% 0.0% 0.0% 21.62sec 544203 299.99sec
Baîr Baîr moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Baîr Baîr natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.37sec 0 299.99sec
Baîr Baîr overwhelming_rage ticks -374037 164257 548 3.97 8284 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.60sec 170832 299.99sec
Baîr Baîr potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.04sec 0 299.99sec
Baîr Baîr shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Baîr Baîr shooting_stars_moonfire ticks -202497 233425 778 0.00 2382 4970 73.1 0.0 31.7% 0.0% 0.0% 0.0% 4.06sec 233425 299.99sec
Baîr Baîr shooting_stars_sunfire ticks -202497 234385 781 0.00 2381 4962 73.5 0.0 31.7% 0.0% 0.0% 0.0% 4.05sec 234385 299.99sec
Baîr Baîr starfire 194153 141651 472 4.73 5264 10537 23.7 23.7 13.7% 0.0% 0.0% 0.0% 11.35sec 141651 299.99sec
Baîr Baîr starsurge 78674 1526915 5090 13.22 17454 35753 66.2 66.1 30.9% 0.0% 0.0% 0.0% 4.51sec 1526915 299.99sec
Baîr Baîr goldrinns_fang 394047 603933 2013 4.34 20549 42145 21.8 21.7 33.7% 0.0% 0.0% 0.0% 13.48sec 603933 299.99sec
Baîr Baîr stellar_flare 202347 25774 86 2.62 1592 3174 12.1 13.1 23.8% 0.0% 0.0% 0.0% 23.99sec 393309 299.99sec
Baîr Baîr stellar_flare ticks -202347 367535 1225 50.08 1145 2386 12.1 250.4 26.0% 0.0% 0.0% 0.0% 23.99sec 393309 299.99sec
Baîr Baîr sunfire 93402 41587 139 3.48 1852 3742 17.4 17.4 28.6% 0.0% 0.0% 0.0% 18.07sec 551880 299.99sec
Baîr Baîr sunfire ticks -93402 510293 1701 50.09 1640 3327 17.4 250.4 23.6% 0.0% 0.0% 0.0% 18.07sec 551880 299.99sec
Baîr Baîr wrath 190984 1193997 3980 19.94 9717 20006 100.1 99.7 21.9% 0.0% 0.0% 0.0% 3.00sec 1193997 299.99sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
18852.1 0.0 Health 0.00% 0.0 100.0% 100%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 241.8s 273.4s 297.1s 99.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Baîr
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 354.8s
  • trigger_min/max:265.2s / 354.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.9s
  • uptime_min/max:97.94% / 99.69%

Stack Uptimes

  • waning_twilight_1:99.62%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 19230.79
Minimum 16804.86
Maximum 22585.62
Spread ( max - min ) 5780.75
Range [ ( max - min ) / 2 * 100% ] 15.03%
Standard Deviation 733.2290
5th Percentile 18086.27
95th Percentile 20485.87
( 95th Percentile - 5th Percentile ) 2399.61
Mean Distribution
Standard Deviation 7.3327
95.00% Confidence Interval ( 19216.42 - 19245.16 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5585
0.1 Scale Factor Error with Delta=300 4590
0.05 Scale Factor Error with Delta=300 18358
0.01 Scale Factor Error with Delta=300 458948
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4642682 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.