SimulationCraft 1026-01      berechnet von Metaux@Antonidas

for World of Warcraft 10.2.6.54358 Live (hotfix 2024-04-23/54358, git build d409f867b8)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Estî : 199588 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
199588.2 199588.2 91.9 / 0.046% 18308.9 / 9.2% 5539.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
36.0 36.3 Rage 0.01% 76.3 100.0% 100%
Origin https://worldofwarcraft.com/en-gb/character/antonidas/est%C3%AE
TalentBgEAAAAAAAAAAAAAAAAAAAAAAEAAAAAAAAAAIBCKJARIBCJRDEiIRQIBSkkESSEhEplSSCIJBAAABEE
Set Bonus
Scale Factors for Estî Damage Per Second
Wdps Str Vers AP Crit WOHdps Mastery Haste
Scale Factors 44.31 9.26 9.09 8.80 8.75 8.16 7.48 5.96
Normalized 4.79 1.00 0.98 0.95 0.95 0.88 0.81 0.64
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.23 0.22 0.22 0.22 0.22 0.22 0.22 0.22
Ranking
  • Wdps > Str ~= Vers > AP ~= Crit > WOHdps > Mastery > Haste
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=9.26, Ap=8.80, CritRating=8.75, HasteRating=5.96, MasteryRating=7.48, Versatility=9.09, Dps=44.31, OffHandDps=8.16 )

Scale Factors for other metrics

Scale Factors for Estî Priority Target Damage Per Second
Wdps Str Vers AP Crit WOHdps Mastery Haste
Scale Factors 44.31 9.26 9.09 8.80 8.75 8.16 7.48 5.96
Normalized 4.79 1.00 0.98 0.95 0.95 0.88 0.81 0.64
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.23 0.22 0.22 0.22 0.22 0.22 0.22 0.22
Ranking
  • Wdps > Str ~= Vers > AP ~= Crit > WOHdps > Mastery > Haste
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=9.26, Ap=8.80, CritRating=8.75, HasteRating=5.96, MasteryRating=7.48, Versatility=9.09, Dps=44.31, OffHandDps=8.16 )
Scale Factors for Estî Damage Per Second (Effective)
Wdps Str Vers AP Crit WOHdps Mastery Haste
Scale Factors 44.31 9.26 9.09 8.80 8.75 8.16 7.48 5.96
Normalized 4.79 1.00 0.98 0.95 0.95 0.88 0.81 0.64
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Vers > AP > Crit > WOHdps > Mastery > Haste
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=9.26, Ap=8.80, CritRating=8.75, HasteRating=5.96, MasteryRating=7.48, Versatility=9.09, Dps=44.31, OffHandDps=8.16 )
Scale Factors for Estî Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for Estî Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for Estî Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for Estî Damage Taken Per Second
Haste Crit Str WOHdps Vers AP Mastery Wdps
Scale Factors 0.11 0.05 0.05 0.03 -0.01 -0.01 -0.02 -0.03
Normalized 2.26 1.06 1.00 0.70 -0.18 -0.19 -0.44 -0.58
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Crit > Str > WOHdps > Vers > AP > Mastery > Wdps
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=0.05, Ap=-0.01, CritRating=0.05, HasteRating=0.11, MasteryRating=-0.02, Versatility=-0.01, Dps=-0.03, OffHandDps=0.03 )
Scale Factors for Estî Damage Taken
Haste Crit Str WOHdps AP Vers Mastery Wdps
Scale Factors 32.25 16.85 14.81 10.29 -2.22 -3.37 -5.55 -6.11
Normalized 2.18 1.14 1.00 0.69 -0.15 -0.23 -0.37 -0.41
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Crit > Str > WOHdps > AP > Vers > Mastery > Wdps
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=14.81, Ap=-2.22, CritRating=16.85, HasteRating=32.25, MasteryRating=-5.55, Versatility=-3.37, Dps=-6.11, OffHandDps=10.29 )
Scale Factors for Estî Healing Taken Per Second
Haste Crit Str WOHdps AP Vers Wdps Mastery
Scale Factors 0.13 0.06 0.05 0.04 0.00 -0.00 -0.02 -0.02
Normalized 2.52 1.10 1.00 0.79 0.01 -0.02 -0.36 -0.40
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Crit > Str > WOHdps > AP > Vers > Wdps > Mastery
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=0.05, Ap=0.00, CritRating=0.06, HasteRating=0.13, MasteryRating=-0.02, Versatility=-0.00, Dps=-0.02, OffHandDps=0.04 )
Scale Factors for Estî Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for EstîTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, )
Scale Factors for Estî Fight Length
Vers Str Mastery Crit Wdps AP Haste WOHdps
Scale Factors 0.00 0.00 0.00 0.00 0.00 0.00 0.00 -0.00
Normalized 1.00 1.00 0.99 0.99 0.99 0.01 0.00 -1.00
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Str > Mastery > Crit > Wdps > AP > Haste > WOHdps
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=0.00, Ap=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00, OffHandDps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Vers AP Crit WOHdps Mastery Haste
Scale Factors 44.31 9.26 9.09 8.80 8.75 8.16 7.48 5.96
Normalized 4.79 1.00 0.98 0.95 0.95 0.88 0.81 0.64
Scale Deltas 595 595 595 595 595 595 595 595
Error 0.23 0.22 0.22 0.22 0.22 0.22 0.22 0.22
Ranking
  • Wdps > Str ~= Vers > AP ~= Crit > WOHdps > Mastery > Haste
Pawn string ( Pawn: v1: "Estî-Fury": Class=Warrior, Spec=Fury, Strength=9.26, Ap=8.80, CritRating=8.75, HasteRating=5.96, MasteryRating=7.48, Versatility=9.09, Dps=44.31, OffHandDps=8.16 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Estî 199588
Annihilator 9900 5.0% 530.3 0.89s 5598 0 Direct 530.3 4256 8652 5598 30.5% 0.0%

Stats Details: Annihilator

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 530.33 530.33 0.00 0.00 0.00 0.0000 0.0000 2968794.70 4241243.42 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.47% 368.42 262 487 4255.57 2222 5296 4255.26 4135 4373 1567826 2239809 30.00%
crit 30.53% 161.92 99 236 8652.42 4444 10593 8652.68 8345 9012 1400968 2001434 30.00%

Action Details: Annihilator

  • id:383915
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:4.0

Spelldata

  • id:383915
  • name:Annihilator
  • school:physical
  • tooltip:Every strike of your next Rampage will deal an additional {$=}w3% damage.
  • description:{$@spelldesc383916=Your auto-attacks deal an additional {$383915s1=0} Physical damage and generate {$=}{{$383915s2=20}/10} Rage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
auto_attack_mh 13478 6.8% 269.9 1.33s 14972 11449 Direct 269.9 12493 24985 14972 20.0% 0.1%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 269.93 269.93 0.00 0.00 0.00 1.3077 0.0000 4041461.32 5773663.37 30.00% 11449.35 11449.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.91% 215.70 155 283 12492.76 6073 17107 12493.21 12024 13026 2694642 3849587 30.00%
crit 19.97% 53.90 25 92 24985.43 12146 34213 24986.72 22304 28077 1346819 1924076 30.00%
miss 0.12% 0.33 0 4 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757430.200Spell Data
Mastery: Unshackled Fury7685631.400Spell DataMastery, Conditional
Battering Ram39431320.200Spell Data
Berserker Stance38619610.150Spell Data
Dancing Blades39168820.300Spell Data
Damage on Debuff Colossus Smash20808620.300
auto_attack_oh 6381 3.2% 261.1 1.33s 7329 5635 Direct 261.1 6114 12225 7330 20.0% 0.1%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 261.06 261.06 0.00 0.00 0.00 1.3007 0.0000 1913423.86 2733532.35 30.00% 5635.23 5635.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.85% 208.47 149 274 6113.50 2970 8384 6113.82 5821 6381 1274452 1820692 30.00%
crit 20.02% 52.27 25 88 12225.25 5940 16768 12225.38 10890 13585 638972 912840 30.00%
miss 0.12% 0.33 0 4 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757430.200Spell Data
Mastery: Unshackled Fury7685631.400Spell DataMastery, Conditional
Battering Ram39431320.200Spell Data
Berserker Stance38619610.150Spell Data
Dancing Blades39168820.300Spell Data
Damage on Debuff Colossus Smash20808620.300
Bloodbath 59828 30.0% 134.7 2.21s 133161 167350 Direct 134.7 50131 204901 133163 53.6% 0.0%

Stats Details: Bloodbath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 134.69 134.69 0.00 0.00 0.00 0.7957 0.0000 17936086.72 25623634.34 30.00% 167350.15 167350.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.35% 62.43 34 92 50130.91 39310 78100 50117.79 46603 54054 3129868 4471354 30.00%
crit 53.65% 72.26 43 104 204901.44 78619 390500 205534.45 182043 239694 14806219 21152280 30.00%

Action Details: Bloodbath

  • id:335096
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:8.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:335096
  • name:Bloodbath
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing {$s1=0} Physical damage and restoring {$117313s1=3}% of your health. |cFFFFFFFFGenerates {$=}{{$s2=80}/10} Rage.|r

Action Priority List

    single_target
    [Q]:134.70
  • if_expr:set_bonus.tier31_2pc

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationWarrior1370471SET1.000
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell CooldownDeft Experience3832952ADD-1500.000
Spell Direct AmountImproved Bloodthirst3838521PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Bloodthirst 3684 1.9% 29.6 8.82s 37414 46585 Direct 29.6 27938 68956 37412 23.1% 0.0%

Stats Details: Bloodthirst

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.64 29.64 0.00 0.00 0.00 0.8032 0.0000 1108804.67 1584047.07 30.00% 46584.52 46584.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.90% 22.79 4 44 27937.94 14840 45941 27892.22 22561 34040 636735 909645 30.00%
crit 23.10% 6.85 0 19 68955.57 29681 219183 68715.26 0 173425 472069 674402 29.97%

Action Details: Bloodthirst

  • id:23881
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:8.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing {$s1=0} Physical damage and restoring {$117313s1=3}% of your health.{$?s385735=false}[ Increases the critical chance of your next Bloodthirst by $s3%. Stacking up to {$u=1} times.][] |cFFFFFFFFGenerates {$=}{{$s2=80}/10} Rage.|r

Action Priority List

    single_target
    [W]:28.22
  • if_expr:(buff.enrage.down|(talent.annihilator&!buff.recklessness.up))&!buff.furious_bloodthirst.up
    single_target
    [X]:0.33
  • if_expr:!talent.wrath_and_fury&!buff.furious_bloodthirst.up
    single_target
    [a]:1.09

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationWarrior1370471SET1.000
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell CooldownDeft Experience3832952ADD-1500.000
Spell Direct AmountImproved Bloodthirst3838521PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Charge (_impact) 14 0.0% 1.0 0.00s 4089 0 Direct 1.0 3360 6720 4089 21.7% 0.0%

Stats Details: Charge Impact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.00 0.0000 0.0000 4088.75 5841.23 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 0.78 0 1 3360.19 3360 3360 2631.63 0 3360 2632 3760 23.50%
crit 21.68% 0.22 0 1 6720.38 6720 6720 1457.12 0 6720 1457 2082 6.51%

Action Details: Charge Impact

  • id:100
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:rage
  • energize_amount:20.0

Spelldata

  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, dealing $126664s2 Physical damage, rooting it for {$105771d=1 second}{$?s103828=false}[, and stunning it for $7922d][]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Execute 0 (5051) 0.0% (2.5%) 21.5 13.08s 70252 87714

Stats Details: Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.53 0.00 0.00 0.00 0.00 0.8009 0.0000 0.00 0.00 0.00% 87713.90 87713.90

Action Details: Execute

  • id:5308
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing {$=}{{$280849s1=0}+{$163558s1=0}} Physical damage. Only usable on enemies that have less than 20% health.{$?s316402=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Rage.|r][]

Action Priority List

    single_target
    [S]:0.81
  • if_expr:buff.enrage.up&!buff.furious_bloodthirst.up&buff.ashen_juggernaut.up|buff.sudden_death.remains<=gcd&(target.health.pct>35&talent.massacre|target.health.pct>20)
    single_target
    [U]:20.60
  • if_expr:buff.enrage.up
    single_target
    [V]:0.11

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationWarrior1370471SET1.000
Hasted Global CooldownWarrior1370472SET1.000
    Execute (_mainhand) 3258 1.6% 0.0 0.00s 0 0 Direct 21.5 36774 73672 45315 23.1% 0.0%

Stats Details: Execute Mainhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 21.53 0.00 0.00 0.00 0.0000 0.0000 975598.15 1393747.19 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.85% 16.55 2 32 36774.40 21794 47228 36737.81 32438 40630 608439 869221 30.00%
crit 23.15% 4.98 0 15 73672.39 43588 94456 73340.64 0 94456 367159 524526 29.89%

Action Details: Execute Mainhand

  • id:280849
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280849
  • name:Execute
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing {$=}{{$280849s1=0}+{$163558s1=0}} Physical damage. Only usable on enemies that have less than 20% health.{$?s316402=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Rage.|r][] }

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Execute Off-Hand 1793 0.9% 0.0 0.00s 0 0 Direct 21.5 20253 40625 24936 23.0% 0.0%

Stats Details: Execute Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 21.53 0.00 0.00 0.00 0.0000 0.0000 536852.58 766951.82 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.01% 16.58 4 33 20253.07 12001 26059 20233.24 17663 22324 335786 479707 30.00%
crit 22.99% 4.95 0 16 40624.98 24002 52118 40375.52 0 52118 201066 287245 29.84%

Action Details: Execute Offhand

  • id:163558
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing {$=}{{$280849s1=0}+{$163558s1=0}} Physical damage. Only usable on enemies that have less than 20% health.{$?s316402=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Rage.|r][] }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Fang Adornments (_oh) 2819 1.4% 65.4 4.55s 12932 0 Direct 65.4 12932 0 12932 0.0% 0.0%

Stats Details: Fang Adornments Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.37 65.37 0.00 0.00 0.00 0.0000 0.0000 845333.62 1207650.25 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 65.37 36 105 12931.52 12788 13427 12931.75 12855 13046 845334 1207650 30.00%

Action Details: Fang Adornments Oh

  • id:377708
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16213.07
  • base_dd_max:16213.07
  • base_dd_mult:1.00

Spelldata

  • id:377708
  • name:Fang Adornments
  • school:physical
  • tooltip:
  • description:Your attacks have a chance to be imbued with ferocity, dealing an additional {$s1=1721} Physical damage.
Gushing Wound 8518 4.3% 79.1 3.75s 32312 0 Periodic 129.2 15009 30620 19780 30.6% 0.0% 83.6%

Stats Details: Gushing Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 79.11 0.00 129.23 129.23 68.58 0.0000 1.9406 2556102.62 2556102.62 0.00% 10192.57 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 69.44% 89.74 52 127 15008.53 7 19380 15007.50 13775 15912 1346810 1346810 0.00%
crit 30.56% 39.49 17 71 30620.40 14 38759 30619.88 26217 33111 1209293 1209293 0.00%

Action Details: Gushing Wound

  • id:385042
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.270000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.52
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:385042
  • name:Gushing Wound
  • school:physical
  • tooltip:Bleeding for {$=}w1 Physical damage every {$t1=2} sec, and healing the Warrior for the same amount.
  • description:{$@spelldesc288080=Bloodthirst critical strikes generate {$=}<rage> additional Rage, and inflict a Gushing Wound that leeches {$=}<damage> health over {$288091d=6 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Periodic AmountBloodborne3857031PCT0.200
Spell Periodic AmountThunderous Words3849691PCT0.150
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Igira's Cruel Nightmare 0 (4843) 0.0% (2.4%) 10.7 25.97s 135385 0

Stats Details: Igiras Cruel Nightmare

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Igiras Cruel Nightmare

  • id:426339
  • school:shadowflame
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426339
  • name:Igira's Cruel Nightmare
  • school:shadowflame
  • tooltip:Your attacks have a low chance to draw torment from your victim to manifest a cruel blade based on the number of nearby enemies, dealing {$=}{{$425838=}w8*({$426527d=6 seconds}/{$426527t1=2})} Shadowflame damage over {$426527d=6 seconds} to solitary foes or {$=}{{$425838=}w9} Fire damage split between all nearby enemies. Damage increased per enemy struck, up to 5.
  • description:Your attacks have a low chance to draw torment from your victim to manifest a cruel blade based on the number of nearby enemies, dealing {$=}{{$425838s8=5214}*({$426527d=6 seconds}/{$426527t1=2})} Shadowflame damage over {$426527d=6 seconds} to solitary foes or {$=}{{$425838s9=12405}} Fire damage split between all nearby enemies. Damage increased per enemy struck, up to 5.
    Flaying Torment 4843 2.4% 10.7 25.97s 135385 0 Periodic 29.8 48814 0 48814 0.0% 0.0% 19.8%

Stats Details: Flaying Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 29.77 29.77 1.87 0.0000 2.0000 1452960.70 1452960.70 0.00% 24407.20 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 29.77 9 67 48814.09 48341 50758 48806.75 48341 49995 1452961 1452961 0.00%

Action Details: Flaying Torment

  • id:426527
  • school:shadowflame
  • range:8.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42901.93
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:426527
  • name:Flaying Torment
  • school:shadowflame
  • tooltip:Suffering {$=}{{$=}w1} Shadowflame damage per sec.
  • description:{$@spelldesc426339=Your attacks have a low chance to draw torment from your victim to manifest a cruel blade based on the number of nearby enemies, dealing {$=}{{$425838s8=5214}*({$426527d=6 seconds}/{$426527t1=2})} Shadowflame damage over {$426527d=6 seconds} to solitary foes or {$=}{{$425838s9=12405}} Fire damage split between all nearby enemies. Damage increased per enemy struck, up to 5. }
Lava Bolt 5358 2.7% 92.3 4.83s 17420 0 Direct 92.3 (92.3) 14522 29046 17420 20.0% (20.0%) 0.0%

Stats Details: Lava Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.33 92.33 0.00 0.00 0.00 0.0000 0.0000 1608285.89 1608285.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.05% 73.91 25 142 14522.22 14401 15121 14519.96 14401 14754 1073271 1073271 0.00%
crit 19.95% 18.42 3 43 29046.23 28803 30243 29041.88 28803 29955 535015 535015 0.00%

Action Details: Lava Bolt

  • id:427037
  • school:firestorm
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12780.83
  • base_dd_max:12780.83
  • base_dd_mult:1.00

Spelldata

  • id:427037
  • name:Lava Bolt
  • school:firestorm
  • tooltip:
  • description:{$@spelldesc426827=Your critical strikes have a chance to summon a lava serpent to attack your target for 10 sec. The serpent spews a lava bolt every 2 sec, dealing {$s1=1553} Volcanic damage. Every third summoning, call forth three serpents instead. If the target dies, the serpent enrages to deal {$s2=2877} Volcanic damage to up to 8 nearby enemies. }
Mark of Fyr'alath 2696 1.4% 2066.4 0.24s 391 0 Periodic 147.0 4581 9163 5499 20.0% 0.0% 97.3%

Stats Details: Mark Of Fyralath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2066.38 0.00 147.04 147.04 2062.42 0.0000 1.9860 808546.22 808546.22 0.00% 2768.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.98% 117.60 81 156 4581.43 4530 4756 4581.51 4565 4600 538780 538780 0.00%
crit 20.02% 29.44 12 56 9163.23 9059 9512 9163.34 9059 9294 269767 269767 0.00%

Action Details: Mark Of Fyralath

  • id:414532
  • school:shadowflame
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:4020.00
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:414532
  • name:Mark of Fyr'alath
  • school:shadowflame
  • tooltip:Suffering {$s1=836} Shadowflame damage every {$t1=3} sec.
  • description:{$@spelldesc420248=Your attacks apply Mark of Fyr'alath, dealing {$414532=}o1 Shadowflame damage over {$414532d=15 seconds}. Upon activation, Fyr'alath draws in the flames from all marks to increase its damage by {$s1=10}%.}
Odyn's Fury 0 (8209) 0.0% (4.1%) 11.2 27.79s 220258 277029

Stats Details: Odyns Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.18 0.00 0.00 0.00 0.00 0.7951 0.0000 0.00 0.00 0.00% 277029.42 277029.42

Action Details: Odyns Fury

  • id:385059
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385059
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r

Action Priority List

    single_target
    [P]:11.18
  • if_expr:(buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)&(talent.dancing_blades&buff.dancing_blades.remains<5|!talent.dancing_blades))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Odyn's Fury (_mh) 6936 3.5% 22.4 27.79s 93048 0 Direct 22.4 30708 62392 40544 31.0% 0.0%
Periodic 44.3 20151 40427 26460 31.1% 0.0% 14.8%

Stats Details: Odyns Fury Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 44.35 44.35 0.00 0.0000 1.0000 2079654.05 2468038.31 15.74% 46892.92 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.96% 15.41 5 24 30708.25 18145 39320 30697.81 28091 33354 473292 676148 30.00%
crit 31.04% 6.94 0 16 62392.38 36290 78640 62379.65 0 74853 432861 618389 29.99%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.88% 30.55 14 46 20150.58 12520 22610 20146.99 19413 20840 615579 615579 0.00%
crit 31.12% 13.80 3 27 40426.76 25041 45219 40429.40 35820 42614 557922 557922 0.00%

Action Details: Odyns Fury Mh

  • id:385060
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.210000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.28
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385060
  • name:Odyn's Fury
  • school:physical
  • tooltip:Suffering {$=}o3 Physical damage over {$d=4 seconds}.
  • description:{$@spelldesc385059=Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountWarrior Fury 10.2 Class Set 2pc4229252PCT0.500
Spell Periodic AmountWarrior Fury 10.2 Class Set 2pc4229253PCT0.500
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Odyn's Fury (_oh) 1273 0.6% 22.4 27.79s 17080 0 Direct 22.4 12937 26299 17081 31.0% 0.0%

Stats Details: Odyns Fury Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 0.00 0.0000 0.0000 381752.30 545374.34 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.99% 15.42 5 26 12937.15 7642 16594 12932.90 11907 13927 199487 284989 30.00%
crit 31.01% 6.93 0 17 26298.94 15284 33187 26296.65 0 33187 182265 260385 29.98%

Action Details: Odyns Fury Oh

  • id:385061
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385061
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc385059=Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountWarrior Fury 10.2 Class Set 2pc4229252PCT0.500
Spell Periodic AmountWarrior Fury 10.2 Class Set 2pc4229253PCT0.500
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Odyn's Fury (_torment) 0 (3108) 0.0% (1.6%) 3.7 90.45s 253175 0

Stats Details: Odyns Fury Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Odyns Fury Torment

  • id:385059
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385059
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Odyn's Fury (_torment_mh) 2598 1.3% 7.4 90.45s 105808 0 Direct 7.4 35244 70519 49383 40.1% 0.0%
Periodic 14.6 20279 40583 28371 39.9% 0.0% 4.9%

Stats Details: Odyns Fury Torment Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.36 7.36 14.63 14.63 0.00 0.0000 1.0000 778256.06 933932.85 16.67% 53203.18 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.92% 4.41 0 8 35243.71 33927 39320 35201.06 0 39320 155338 221918 29.95%
crit 40.08% 2.95 0 8 70518.59 67854 78640 68831.80 0 78640 207877 296974 29.28%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.14% 8.80 1 16 20278.71 19509 22610 20287.69 19509 22197 178412 178412 0.00%
crit 39.86% 5.83 0 14 40582.76 39017 45219 40564.55 0 45219 236629 236629 0.00%

Action Details: Odyns Fury Torment Mh

  • id:385060
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.210000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.28
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385060
  • name:Odyn's Fury
  • school:physical
  • tooltip:Suffering {$=}o3 Physical damage over {$d=4 seconds}.
  • description:{$@spelldesc385059=Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountWarrior Fury 10.2 Class Set 2pc4229252PCT0.500
Spell Periodic AmountWarrior Fury 10.2 Class Set 2pc4229253PCT0.500
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Odyn's Fury (_torment_oh) 510 0.3% 7.4 90.45s 20779 0 Direct 7.4 14850 29718 20779 39.9% 0.0%

Stats Details: Odyns Fury Torment Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.36 7.36 0.00 0.00 0.00 0.0000 0.0000 152838.84 218346.77 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.12% 4.42 0 8 14850.03 14288 16594 14831.55 0 16594 65670 93816 29.95%
crit 39.88% 2.93 0 8 29718.23 28577 33187 28943.65 0 33187 87169 124531 29.20%

Action Details: Odyns Fury Torment Oh

  • id:385061
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385061
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc385059=Unleashes your power, dealing {$=}{$385060sw1+$385062sw1+$385061sw1+$385061sw1} Physical damage and an additional {$385060=}o2 Physical damage over {$385060d=4 seconds} to all enemies within {$385060=}A2 yards. |cFFFFFFFFGenerates {$=}{{$s5=150}/10} Rage.|r }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountWarrior Fury 10.2 Class Set 2pc4229252PCT0.500
Spell Periodic AmountWarrior Fury 10.2 Class Set 2pc4229253PCT0.500
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Rage of Fyr'alath (_channel) 0 (7866) 0.0% (3.9%) 3.0 120.27s 782914 411762

Stats Details: Rage Of Fyralath Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 20.80 0.00 0.00 1.9014 0.2725 0.00 0.00 0.00% 411761.66 411761.66

Action Details: Rage Of Fyralath Channel

  • id:417132
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:417132
  • name:Rage of Fyr'alath
  • school:physical
  • tooltip:
  • description:{$@spelldesc417131=Unleash the Rage of Fyr'alath to charge towards your target and swing repeatedly, dealing {$=}{{$417134s1=10777}*{$417132d=3 seconds}/{$417132t1=0.500}+{$413584s1=43093}} Shadowflame damage over {$417132d=3 seconds} to all who would stand in your way.}
    Rage of Fyr'alath 4732 2.3% 17.8 15.24s 78670 0 Direct 17.8 65284 130654 78667 20.5% 0.0%

Stats Details: Rage Of Fyralath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 0.00 0.00 0.00 0.0000 0.0000 1403361.33 1403361.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.52% 14.19 5 18 65283.61 64213 67423 65287.71 64460 66621 926101 926101 0.00%
crit 20.48% 3.65 0 10 130653.50 128425 134846 128437.75 0 134846 477260 477260 0.00%

Action Details: Rage Of Fyralath

  • id:417134
  • school:shadowflame
  • range:50.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51807.45
  • base_dd_max:51807.45
  • base_dd_mult:1.00

Spelldata

  • id:417134
  • name:Rage of Fyr'alath
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc417131=Unleash the Rage of Fyr'alath to charge towards your target and swing repeatedly, dealing {$=}{{$417134s1=10777}*{$417132d=3 seconds}/{$417132t1=0.500}+{$413584s1=43093}} Shadowflame damage over {$417132d=3 seconds} to all who would stand in your way.}
    Explosive Rage 3134 1.6% 3.0 121.36s 312145 0 Direct 3.0 261047 522465 314098 20.3% 0.0%

Stats Details: Explosive Rage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 2.96 0.00 0.00 0.00 0.0000 0.0000 930503.76 930503.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 2.36 0 3 261046.92 256751 269589 258442.17 0 269589 616368 616368 0.00%
crit 20.30% 0.60 0 3 522464.55 513502 539177 255224.11 0 539177 314136 314136 0.00%

Action Details: Explosive Rage

  • id:413584
  • school:shadowflame
  • range:50.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:207148.07
  • base_dd_max:207148.07
  • base_dd_mult:1.00

Spelldata

  • id:413584
  • name:Explosive Rage
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc417131=Unleash the Rage of Fyr'alath to charge towards your target and swing repeatedly, dealing {$=}{{$417134s1=10777}*{$417132d=3 seconds}/{$417132t1=0.500}+{$413584s1=43093}} Shadowflame damage over {$417132d=3 seconds} to all who would stand in your way.}
Rampage 0 (31855) 0.0% (16.0%) 135.1 2.21s 70751 88631

Stats Details: Rampage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 135.06 0.00 0.00 0.00 0.00 0.7983 0.0000 0.00 0.00 0.00% 88630.92 88630.92

Action Details: Rampage

  • id:184367
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rage
  • base_cost:80
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of {$s1=4} brutal strikes for a total of {$=}<damage> Physical damage{$?a396749=true}[ and greatly empowering your next {$396749s3=2} Bloodthirsts or Raging Blows][].

Action Priority List

    single_target
    [T]:110.03
  • if_expr:talent.reckless_abandon&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
    single_target
    [Y]:25.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Slaughtering Strikes39394310.020Spell Data
Slaughtering Strikes39393110.200Spell Data
    Rampage (1) 6283 3.1% 0.0 0.00s 0 0 Direct 135.1 10432 20979 13954 33.4% 0.0%

Stats Details: Rampage1

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 135.06 0.00 0.00 0.00 0.0000 0.0000 1884644.55 2692418.00 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.60% 89.96 56 128 10432.12 8737 13394 10431.84 10071 10820 938426 1340643 30.00%
crit 33.40% 45.10 21 78 20979.24 17475 26789 20984.99 19776 22626 946219 1351775 30.00%

Action Details: Rampage1

  • id:184707
  • school:physical
  • range:8.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of {$s1=4} brutal strikes for a total of {$=}<damage> Physical damage{$?a396749=true}[ and greatly empowering your next {$396749s3=2} Bloodthirsts or Raging Blows][].}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Slaughtering Strikes39394310.020Spell Data
Slaughtering Strikes39393110.200Spell Data
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Rampage (2) 7494 3.8% 0.0 0.00s 0 0 Direct 135.0 12467 25076 16653 33.2% 0.0%

Stats Details: Rampage2

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 134.99 0.00 0.00 0.00 0.0000 0.0000 2248025.23 3211546.49 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.80% 90.18 55 126 12466.67 10421 15943 12466.29 12020 12891 1124233 1606088 30.00%
crit 33.20% 44.82 19 78 25075.94 20843 31886 25082.42 23035 26908 1123792 1605459 30.00%

Action Details: Rampage2

  • id:184709
  • school:physical
  • range:8.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of {$s1=4} brutal strikes for a total of {$=}<damage> Physical damage{$?a396749=true}[ and greatly empowering your next {$396749s3=2} Bloodthirsts or Raging Blows][].}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Slaughtering Strikes39394310.020Spell Data
Slaughtering Strikes39393110.200Spell Data
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Rampage (3) 8406 4.2% 0.0 0.00s 0 0 Direct 134.9 14005 28191 18698 33.1% 0.0%

Stats Details: Rampage3

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 134.86 0.00 0.00 0.00 0.0000 0.0000 2521569.02 3602333.30 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.92% 90.25 55 125 14005.25 11650 17859 14004.33 13504 14507 1264006 1805768 30.00%
crit 33.08% 44.61 16 76 28191.00 23300 35718 28197.27 26396 30195 1257563 1796565 30.00%

Action Details: Rampage3

  • id:201364
  • school:physical
  • range:8.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of {$s1=4} brutal strikes for a total of {$=}<damage> Physical damage{$?a396749=true}[ and greatly empowering your next {$396749s3=2} Bloodthirsts or Raging Blows][].}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Slaughtering Strikes39394310.020Spell Data
Slaughtering Strikes39393110.200Spell Data
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Rampage (4) 9673 4.8% 0.0 0.00s 0 0 Direct 134.8 16119 32452 21518 33.1% 0.0%

Stats Details: Rampage4

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 134.84 0.00 0.00 0.00 0.0000 0.0000 2901503.91 4145111.27 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.94% 90.26 59 131 16119.10 13399 20498 16118.17 15531 16738 1454972 2078584 30.00%
crit 33.06% 44.57 19 80 32451.84 26798 40996 32459.36 30155 34890 1446532 2066527 30.00%

Action Details: Rampage4

  • id:201363
  • school:physical
  • range:8.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of {$s1=4} brutal strikes for a total of {$=}<damage> Physical damage{$?a396749=true}[ and greatly empowering your next {$396749s3=2} Bloodthirsts or Raging Blows][].}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Slaughtering Strikes39394310.020Spell Data
Slaughtering Strikes39393110.200Spell Data
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Roiling Shadowflame 2575 1.3% 53.2 5.57s 14525 0 Direct 53.2 12108 24176 14525 20.0% 0.0%

Stats Details: Roiling Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.18 53.18 0.00 0.00 0.00 0.0000 0.0000 772468.01 772468.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.98% 42.53 21 65 12108.41 8042 16888 12107.22 11215 13044 515013 515013 0.00%
crit 20.02% 10.65 1 26 24176.18 16084 33776 24178.03 16084 31765 257455 257455 0.00%

Action Details: Roiling Shadowflame

  • id:406251
  • school:shadowflame
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7137.39
  • base_dd_max:7137.39
  • base_dd_mult:1.00

Spelldata

  • id:406251
  • name:Roiling Shadowflame
  • school:shadowflame
  • tooltip:Suffering {$=}w1 Shadowflame damage.
  • description:{$@spelldesc406254=Dealing damage has a chance to rouse the Shadowflame, inflicting {$s2=867} Shadowflame damage upon your target and {$s3=116} Shadowflame damage to yourself. Whenever this happens, you gain a stack of Roused Shadowflame. Roused Shadowflame increases this effects damage by {$s4=20}%, stacking {$406887u=5} times. Upon reaching maximum stacks, the Roused Shadowflame will subside.}
Sidearm 3402 1.7% 106.1 3.05s 9615 0 Direct 106.0 7316 14871 9622 30.5% 0.0%

Stats Details: Sidearm

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.10 106.02 0.00 0.00 0.00 0.0000 0.0000 1020128.64 1457363.78 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.48% 73.67 39 119 7316.21 4200 9102 7315.47 6947 7718 538983 769995 30.00%
crit 30.52% 32.35 11 63 14871.18 8400 18204 14871.65 13400 16032 481146 687369 30.00%

Action Details: Sidearm

  • id:384391
  • school:physical
  • range:5.0
  • travel_speed:35.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384391
  • name:Sidearm
  • school:physical
  • tooltip:
  • description:{$@spelldesc384404=Your auto-attacks have a {$s2=20}% chance to hurl weapons at your target and 3 other enemies in front of you, dealing an additional {$384391s1=0} Physical damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Slam 3637 1.8% 20.6 11.56s 53148 66330 Direct 20.6 37414 78432 53149 38.4% 0.0%

Stats Details: Slam

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.59 20.59 0.00 0.00 0.00 0.8013 0.0000 1094119.45 1563067.63 30.00% 66330.37 66330.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.64% 12.69 3 27 37414.26 22580 48932 37386.58 33015 42977 474771 678261 30.00%
crit 38.36% 7.90 0 18 78431.63 47419 102757 78357.18 0 95594 619349 884806 30.00%

Action Details: Slam

  • id:1464
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rage
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing {$s1=0} Physical damage.{$?s388903=true}[ |cFFFFFFFFGenerates {$=}{{$388903s6=100}/10} Rage.][]

Action Priority List

    single_target
    [Z]:20.59
  • if_expr:talent.annihilator

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationWarrior1370471SET1.000
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell CooldownStorm of Swords3889032ADD9000.000
Spell Direct AmountStorm of Swords3889034PCT1.000
Spell Resource CostStorm of Swords3889035ADD-20.000
Spell Direct AmountBarbaric Training3906741PCT0.200
Spell Critical DamageBarbaric Training3906742PCT0.100
Spell Direct AmountCrushing Force3827641PCT0.600
Spell Critical ChanceCrushing Force3827642ADD0.150
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Storm Bolt 19 0.0% 0.6 90.93s 9266 11513 Direct 0.6 7632 15285 9268 21.3% 0.0%

Stats Details: Storm Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.62 0.62 0.00 0.00 0.00 0.8056 0.0000 5722.06 8174.58 30.00% 11513.19 11513.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.66% 0.49 0 4 7632.04 4788 9429 3092.08 0 9429 3707 5296 12.15%
crit 21.34% 0.13 0 3 15285.08 9577 18859 1919.85 0 18859 2015 2878 3.77%

Action Details: Storm Bolt

  • id:107570
  • school:physical
  • range:20.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:107570
  • name:Storm Bolt
  • school:physical
  • tooltip:Stunned.
  • description:Hurls your weapon at an enemy, causing {$s1=0} Physical damage and stunning for {$132169d=4 seconds}.

Action Priority List

    single_target
    [c]:0.62

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Thunderous Roar 871 (5550) 0.4% (2.8%) 3.7 90.60s 449049 567968 Direct 3.7 (42.4) 50224 100664 70480 40.2% (40.2%) 0.0%

Stats Details: Thunderous Roar

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.70 3.70 0.00 0.00 0.00 0.7908 0.0000 260846.27 372647.03 30.00% 567967.80 567967.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.84% 2.21 0 4 50224.42 45236 62912 48518.66 0 62912 111224 158896 28.96%
crit 40.16% 1.49 0 4 100664.13 90472 125825 85359.90 0 125825 149622 213751 25.42%

Action Details: Thunderous Roar

  • id:384318
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:10.0

Spelldata

  • id:384318
  • name:Thunderous Roar
  • school:physical
  • tooltip:
  • description:Roar explosively, dealing {$s1=0} Physical damage to enemies within {$=}A1 yds and cause them to bleed for {$397364=}o1 physical damage over {$397364d=8 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=100}/10} Rage.

Action Priority List

    single_target
    [R]:3.70
  • if_expr:buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Thunderous Roar (_dot) 4679 2.3% 3.7 90.60s 378567 0 Periodic 38.7 25856 51971 36206 39.6% 0.0% 12.2%

Stats Details: Thunderous Roar Dot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.70 0.00 38.70 38.70 0.00 0.0000 0.9443 1401027.52 1401027.52 0.00% 38341.25 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.37% 23.36 10 36 25856.36 900 31008 25875.01 22792 29046 604059 604059 0.00%
crit 39.63% 15.33 3 28 51970.90 1800 62015 52005.04 37802 58871 796968 796968 0.00%

Action Details: Thunderous Roar Dot

  • id:397364
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.432000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.52
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:397364
  • name:Thunderous Roar
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.{$?a424742=false}[ Damage taken increased by {$=}w2%.][]
  • description:{$@spelldesc384318=Roar explosively, dealing {$s1=0} Physical damage to enemies within {$=}A1 yds and cause them to bleed for {$397364=}o1 physical damage over {$397364d=8 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=100}/10} Rage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Periodic AmountBloodborne3857031PCT0.200
Spell Periodic AmountThunderous Words3849691PCT0.150
Spell DurationThunderous Words3849692ADD2000.000
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Vicious Brand 9566 4.8% 32.6 9.02s 88613 0 Periodic 152.8 (152.8) 15753 31507 18892 19.9% (19.9%) 0.0% 50.9% (50.9%)

Stats Details: Vicious Brand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.58 0.00 152.80 152.80 14.45 0.0000 1.0000 2886701.28 2886701.28 0.00% 18891.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.08% 122.36 62 192 15753.31 1557 23987 15564.46 6967 19936 1927604 1927604 0.00%
crit 19.92% 30.44 10 59 31507.14 3114 47975 31116.42 11290 43035 959098 959098 0.00%

Action Details: Vicious Brand

  • id:425154
  • school:fire
  • range:15.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1315.94
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:425154
  • name:Vicious Brand
  • school:fire
  • tooltip:Taking {$=}w2 Fire damage per {$t2=1} sec.
  • description:{$@spelldesc422479=Your melee attacks and abilities have a chance to viciously brand your target, dealing {$=}{{$s1=5942}*((1+{$s3=20}/100)^(1-{$s5=10}))} Fire damage over 6 sec, and grant you {$@=}spellname425153, stacking up to 15 times. Damage increased per stack to a maximum of {$=}{{$s1=5942}*((1+{$s3=20}/100)^({$s2=15}-{$s5=10}))}. While above 5 stacks, also deals {$s4=50}% of its damage to you. At 15 stacks, enemies near your target suffer {$s6=10}% of the damage dealt split between them. {$@=}spellname425153 decays every {$425153t2=5} sec while out of combat and fades entirely after {$s8=15} sec.}
    Radiating Brand 0 0.0% 82.9 1.89s

Stats Details: Radiating Brand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.93 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Radiating Brand

  • id:425156
  • school:fire
  • range:15.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2284.52
  • base_dd_max:2284.52
  • base_dd_mult:1.00

Spelldata

  • id:425156
  • name:Radiating Brand
  • school:fire
  • tooltip:
  • description:{$@spelldesc422479=Your melee attacks and abilities have a chance to viciously brand your target, dealing {$=}{{$s1=5942}*((1+{$s3=20}/100)^(1-{$s5=10}))} Fire damage over 6 sec, and grant you {$@=}spellname425153, stacking up to 15 times. Damage increased per stack to a maximum of {$=}{{$s1=5942}*((1+{$s3=20}/100)^({$s2=15}-{$s5=10}))}. While above 5 stacks, also deals {$s4=50}% of its damage to you. At 15 stacks, enemies near your target suffer {$s6=10}% of the damage dealt split between them. {$@=}spellname425153 decays every {$425153t2=5} sec while out of combat and fades entirely after {$s8=15} sec.}
Whirlwind 0 (1231) 0.0% (0.6%) 10.7 18.65s 34584 43084

Stats Details: Whirlwind

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.71 0.00 0.00 0.00 0.00 0.8028 0.0000 0.00 0.00 0.00% 43083.94 43083.94

Action Details: Whirlwind

  • id:190411
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:190411
  • name:Whirlwind
  • school:physical
  • tooltip:
  • description:Unleashes a whirlwind of steel, striking all nearby enemies for {$=}<damage> Physical damage. Deals reduced damage beyond {$s3=5} targets.{$?s12950=true}[ Causes your next {$85739u=2} single-target melee {$=}lattack:attacks; to strike up to {$85739s1=4} additional targets for {$85739s3=55}% damage.][]{$?s12950=true}[ |cFFFFFFFFGenerates {$s1=3} Rage, plus an additional {$s2=1} per target hit.|r][]

Action Priority List

    single_target
    [b]:10.71

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationWarrior1370471SET1.000
Hasted Global CooldownWarrior1370472SET1.000
Spell CooldownStorm of Swords3889031ADD7000.000
Spell Direct AmountStorm of Swords3889033PCT0.800
    Whirlwind (_mh_first) 270 0.1% 10.7 18.65s 7582 0 Direct 10.7 6106 12814 7581 22.0% 0.0%

Stats Details: Whirlwind Mh First

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 0.00 0.0000 0.0000 81218.26 116029.04 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.01% 8.36 0 19 6106.21 3765 8159 6100.23 0 7040 51026 72896 29.99%
crit 21.99% 2.36 0 10 12814.22 7907 17134 11624.46 0 17134 30193 43133 27.24%

Action Details: Whirlwind Mh First

  • id:199667
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:199667
  • name:Whirlwind
  • school:physical
  • tooltip:
  • description:{$@spelldesc190411=Unleashes a whirlwind of steel, striking all nearby enemies for {$=}<damage> Physical damage. Deals reduced damage beyond {$s3=5} targets.{$?s12950=true}[ Causes your next {$85739u=2} single-target melee {$=}lattack:attacks; to strike up to {$85739s1=4} additional targets for {$85739s3=55}% damage.][]{$?s12950=true}[ |cFFFFFFFFGenerates {$s1=3} Rage, plus an additional {$s2=1} per target hit.|r][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountMeat Cleaver2803921PCT0.250
Spell Direct AmountStorm of Swords3889033PCT0.800
Spell Direct AmountBarbaric Training3906741PCT0.200
Spell Critical DamageBarbaric Training3906742PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Merciless Bonegrinder38331610.500Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Whirlwind (_mh_others) 538 0.3% 21.4 8.88s 7554 0 Direct 21.4 6100 12798 7554 21.7% 0.0%

Stats Details: Whirlwind Mh Others

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.42 21.42 0.00 0.00 0.00 0.0000 0.0000 161821.28 231179.15 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 16.77 0 38 6100.45 3765 8159 6095.26 0 7174 102333 146193 30.00%
crit 21.70% 4.65 0 17 12797.84 7907 17134 12619.75 0 16349 59489 84986 29.60%

Action Details: Whirlwind Mh Others

  • id:199852
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:199852
  • name:Whirlwind
  • school:physical
  • tooltip:
  • description:{$@spelldesc190411=Unleashes a whirlwind of steel, striking all nearby enemies for {$=}<damage> Physical damage. Deals reduced damage beyond {$s3=5} targets.{$?s12950=true}[ Causes your next {$85739u=2} single-target melee {$=}lattack:attacks; to strike up to {$85739s1=4} additional targets for {$85739s3=55}% damage.][]{$?s12950=true}[ |cFFFFFFFFGenerates {$s1=3} Rage, plus an additional {$s2=1} per target hit.|r][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountMeat Cleaver2803921PCT0.250
Spell Direct AmountStorm of Swords3889033PCT0.800
Spell Direct AmountBarbaric Training3906741PCT0.200
Spell Critical DamageBarbaric Training3906742PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Merciless Bonegrinder38331610.500Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Whirlwind Off-Hand (whirlwind_oh_first) 141 0.1% 10.7 18.65s 3967 0 Direct 10.7 3204 6719 3967 21.7% 0.0%

Stats Details: Whirlwind Oh First

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 0.00 0.0000 0.0000 42492.59 60705.25 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 8.39 0 21 3203.63 1975 4288 3201.11 0 3990 26871 38388 30.00%
crit 21.70% 2.32 0 10 6719.48 4147 9004 6052.72 0 9004 15621 22317 27.04%

Action Details: Whirlwind Oh First

  • id:44949
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:44949
  • name:Whirlwind Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc190411=Unleashes a whirlwind of steel, striking all nearby enemies for {$=}<damage> Physical damage. Deals reduced damage beyond {$s3=5} targets.{$?s12950=true}[ Causes your next {$85739u=2} single-target melee {$=}lattack:attacks; to strike up to {$85739s1=4} additional targets for {$85739s3=55}% damage.][]{$?s12950=true}[ |cFFFFFFFFGenerates {$s1=3} Rage, plus an additional {$s2=1} per target hit.|r][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountMeat Cleaver2803921PCT0.250
Spell Direct AmountStorm of Swords3889033PCT0.800
Spell Direct AmountBarbaric Training3906741PCT0.200
Spell Critical DamageBarbaric Training3906742PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Merciless Bonegrinder38331610.500Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
    Whirlwind Off-Hand (whirlwind_oh_others) 282 0.1% 21.4 8.88s 3965 0 Direct 21.4 3200 6713 3965 21.8% 0.0%

Stats Details: Whirlwind Oh Others

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.42 21.42 0.00 0.00 0.00 0.0000 0.0000 84946.65 121355.45 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.23% 16.76 0 39 3200.32 1975 4288 3197.66 0 3765 53632 76619 30.00%
crit 21.77% 4.66 0 18 6713.18 4147 9004 6613.93 0 9004 31315 44737 29.56%

Action Details: Whirlwind Oh Others

  • id:199851
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:199851
  • name:Whirlwind Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc190411=Unleashes a whirlwind of steel, striking all nearby enemies for {$=}<damage> Physical damage. Deals reduced damage beyond {$s3=5} targets.{$?s12950=true}[ Causes your next {$85739u=2} single-target melee {$=}lattack:attacks; to strike up to {$85739s1=4} additional targets for {$85739s3=55}% damage.][]{$?s12950=true}[ |cFFFFFFFFGenerates {$s1=3} Rage, plus an additional {$s2=1} per target hit.|r][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFury Warrior1370501PCT0.050
Spell Periodic AmountFury Warrior1370502PCT0.050
Spell Direct AmountMeat Cleaver2803921PCT0.250
Spell Direct AmountStorm of Swords3889033PCT0.800
Spell Direct AmountBarbaric Training3906741PCT0.200
Spell Critical DamageBarbaric Training3906742PCT0.100
Spell Direct AmountDual Wield Specialization3829001PCT0.050
Spell Periodic AmountDual Wield Specialization3829002PCT0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Avatar10757410.200Spell Data
Merciless Bonegrinder38331610.500Spell Data
Mastery: Unshackled Fury7685611.400Spell DataMastery, Conditional
Periodic Damage Avatar10757440.200Spell Data
Mastery: Unshackled Fury7685621.400Spell DataMastery, Conditional
Critical Strike Chance Recklessness171910.200Spell Data
Damage on Debuff Colossus Smash20808610.300
Simple Action Stats Execute Interval
Estî
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avatar 3.7 90.45s

Stats Details: Avatar

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Avatar

  • id:107574
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:10.0

Spelldata

  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage{$?s394314=false}[, take {$394314s2=10}% reduced damage][] and removing all roots and snares. |cFFFFFFFFGenerates {$=}{{$s2=100}/10} Rage.|r

Action Priority List

    default
    [L]:3.68
  • if_expr:talent.titans_torment&buff.enrage.up&raid_event.adds.in>15&!buff.avatar.up&cooldown.odyns_fury.remains|talent.berserkers_torment&buff.enrage.up&!buff.avatar.up&raid_event.adds.in>15|!talent.titans_torment&!talent.berserkers_torment&(buff.recklessness.up|target.time_to_die<20)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Avatar (_torment) 11.2 27.79s

Stats Details: Avatar Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Avatar Torment

  • id:107574
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rage
  • energize_amount:10.0

Spelldata

  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage{$?s394314=false}[, take {$394314s2=10}% reduced damage][] and removing all roots and snares. |cFFFFFFFFGenerates {$=}{{$s2=100}/10} Rage.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Berserker Stance 1.0 0.00s

Stats Details: Berserker Stance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserker Stance

  • id:386196
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:386196
  • name:Berserker Stance
  • school:physical
  • tooltip:Auto-attack damage increased by {$s1=15}% and the effects of Fear, Sap and Incapacitate are reduced by {$s2=10}%.
  • description:An aggressive combat state that increases the damage of your auto-attacks by {$s1=15}% and reduces the duration of Fear, Sap and Incapacitate effects on you by {$s2=10}%. Lasts until canceled.
Bloodthirst Heal 164.3 1.81s

Stats Details: Bloodthirst Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 164.33 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodthirst Heal

  • id:117313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:117313
  • name:Bloodthirst Heal
  • school:physical
  • tooltip:
  • description:Bloodthirst heals the Warrior for {$s1=3}% of their health.
Charge 1.0 0.00s

Stats Details: Charge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Charge

  • id:100
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:17.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, dealing $126664s2 Physical damage, rooting it for {$105771d=1 second}{$?s103828=false}[, and stunning it for $7922d][]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r

Action Priority List

    default
    [I]:1.00
  • if_expr:time<=0.5|movement.distance>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382156
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Lava Bolt (_dot) 11.7 25.05s

Stats Details: Lava Bolt Dot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.70 0.00 57.38 0.00 0.00 0.0000 2.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Lava Bolt Dot

  • id:427059
  • school:firestorm
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:427059
  • name:Lava Bolt
  • school:firestorm
  • tooltip:
  • description:{$@spelldesc426827=Your critical strikes have a chance to summon a lava serpent to attack your target for 10 sec. The serpent spews a lava bolt every 2 sec, dealing {$s1=1553} Volcanic damage. Every third summoning, call forth three serpents instead. If the target dies, the serpent enrages to deal {$s2=2877} Volcanic damage to up to 8 nearby enemies. }
Elemental Potion of Ultimate Power 1.5 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [J]:1.50
Recklessness 3.7 90.17s

Stats Details: Recklessness

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Recklessness

  • id:1719
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Estî
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:rage
  • energize_amount:50.0

Spelldata

  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Rage generation increased by {$s5=100}%. Critical strike chance of all abilities increased by {$=}w1%.{$?a202751=true}[ Bloodthirst and Raging Blow upgraded to {$@=}spellname335096 and {$@=}spellname335097.][]
  • description:Go berserk, increasing all Rage generation by {$s4=100}% and granting your abilities {$s1=20}% increased critical strike chance for {$d=12 seconds}.{$?a396749=true}[ |cFFFFFFFFGenerates {$=}{{$s3=0}/10} Rage.|r][]

Action Priority List

    default
    [M]:3.73
  • if_expr:!raid_event.adds.exists&(talent.annihilator&cooldown.champions_spear.remains<1|cooldown.avatar.remains>40|!talent.avatar|target.time_to_die<12)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownWarrior1370472SET1.000

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Avatar 11.8 0.0 26.1s 26.1s 9.8s 38.66% 45.47% 0.0 (0.0) 11.5

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_avatar
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 58.1s
  • trigger_min/max:4.0s / 58.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.4s
  • uptime_min/max:34.66% / 42.81%

Stack Uptimes

  • avatar_1:38.66%

Spelldata

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage{$?s394314=false}[, take {$394314s2=10}% reduced damage][] and removing all roots and snares. |cFFFFFFFFGenerates {$=}{{$s2=100}/10} Rage.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.7s 50.1s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 340.0s
  • trigger_min/max:15.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.7s
  • uptime_min/max:47.15% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dancing Blades 11.6 3.2 26.6s 20.5s 12.1s 47.15% 54.56% 3.2 (3.2) 11.2

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_dancing_blades
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 52.1s
  • trigger_min/max:4.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:40.91% / 53.33%

Stack Uptimes

  • dancing_blades_1:47.15%

Spelldata

  • id:391688
  • name:Dancing Blades
  • tooltip:Auto-attack damage and speed increased by {$s1=30}%.
  • description:@spelldesc391683
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.2s 0.0s 27.5s 13.47% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 300.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.99% / 18.18%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.47%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Enrage 3.9 180.4 73.2s 1.6s 75.7s 98.86% 0.00% 180.4 (180.4) 2.9

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_enrage
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 329.4s
  • trigger_min/max:0.0s / 9.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.3s
  • uptime_min/max:96.67% / 99.51%

Stack Uptimes

  • enrage_1:98.86%

Spelldata

  • id:184362
  • name:Enrage
  • tooltip:Damage done increased by {$76856s1=0}%{$?s383848=true}[, Haste increased by {$m1=15}%, Movement speed increased by {$m2=10}%.][.]{$?s208154=true}[ Damage taken reduced by {$208154m3=0}%.][]
  • description:{$@spelldesc184361=Becoming Enraged increases your damage done by {$76856s1=0}%{$?=}(s316424&s316425)[, Haste by {$184362s1=15}%, and movement speed by {$184362s2=10}% for {$184362d=4 seconds}.]?s316424[, and your Haste by {$184362s1=15}%.][ for {$184362d=4 seconds}.] {$@=}spellicon23881 Bloodthirst has a {$m2=30}% chance to Enrage you.{$?s316412=true}[ {$@=}spellicon184367 Rampage always Enrages you.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Firestarter 1.0 31.6 0.0s 9.0s 292.3s 97.39% 0.00% 17.6 (17.6) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_firestarter
  • max_stacks:15
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:217.1s / 358.2s
  • uptime_min/max:88.90% / 99.52%

Stack Uptimes

  • firestarter_1:2.48%
  • firestarter_2:2.50%
  • firestarter_3:2.56%
  • firestarter_4:2.76%
  • firestarter_5:2.96%
  • firestarter_6:3.04%
  • firestarter_7:3.16%
  • firestarter_8:3.16%
  • firestarter_9:3.16%
  • firestarter_10:3.22%
  • firestarter_11:3.18%
  • firestarter_12:3.21%
  • firestarter_13:3.22%
  • firestarter_14:3.20%
  • firestarter_15:55.58%

Spelldata

  • id:425153
  • name:Firestarter
  • tooltip:The heat of the brand intensifies, increasing the damage dealt by {$@=}spellname425154.
  • description:{$@spelldesc422479=Your melee attacks and abilities have a chance to viciously brand your target, dealing {$=}{{$s1=5942}*((1+{$s3=20}/100)^(1-{$s5=10}))} Fire damage over 6 sec, and grant you {$@=}spellname425153, stacking up to 15 times. Damage increased per stack to a maximum of {$=}{{$s1=5942}*((1+{$s3=20}/100)^({$s2=15}-{$s5=10}))}. While above 5 stacks, also deals {$s4=50}% of its damage to you. At 15 stacks, enemies near your target suffer {$s6=10}% of the damage dealt split between them. {$@=}spellname425153 decays every {$425153t2=5} sec while out of combat and fades entirely after {$s8=15} sec.}
  • max_stacks:15
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Frenzy 1.0 134.1 0.0s 2.2s 297.9s 99.31% 0.00% 131.1 (131.1) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_frenzy
  • max_stacks:4
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.5s / 9.4s
  • trigger_pct:100.00%
  • duration_min/max:235.8s / 358.2s
  • uptime_min/max:98.25% / 99.53%

Stack Uptimes

  • frenzy_1:1.00%
  • frenzy_2:0.51%
  • frenzy_3:0.51%
  • frenzy_4:97.28%

Spelldata

  • id:335082
  • name:Frenzy
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc335077=Rampage increases your Haste by {$335082s1=2}% for {$335082d=12 seconds}, stacking up to {$335082u=4} times. This effect is reset if you Rampage a different primary target.}
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Furious Bloodthirst 13.5 1.3 22.6s 20.5s 5.2s 23.51% 26.89% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_furious_bloodthirst
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.6s / 39.9s
  • trigger_min/max:4.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.6s
  • uptime_min/max:20.05% / 28.50%

Stack Uptimes

  • furious_bloodthirst_1:8.54%
  • furious_bloodthirst_2:8.72%
  • furious_bloodthirst_3:6.16%
  • furious_bloodthirst_4:0.09%
  • furious_bloodthirst_5:0.00%

Spelldata

  • id:423211
  • name:Furious Bloodthirst
  • tooltip:Bloodthirst damage increased by {$=}w1% and critical strike chance increased by {$=}w2% against its primary target.
  • description:{$@spelldesc422925=Odyn's Fury deals {$s2=50}% increased damage and causes your next {$423211s3=3} Bloodthirsts to deal {$423211s1=150}% additional damage and have {$423211s2=100}% increased critical strike chance against its primary target.}
  • max_stacks:6
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Whirlwind (meat_cleaver) 10.7 0.0 18.9s 18.8s 3.6s 12.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_meat_cleaver
  • max_stacks:4
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.8s / 177.8s
  • trigger_min/max:3.0s / 177.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s
  • uptime_min/max:0.00% / 25.72%

Stack Uptimes

  • meat_cleaver_1:3.24%
  • meat_cleaver_2:2.36%
  • meat_cleaver_3:3.92%
  • meat_cleaver_4:3.36%

Spelldata

  • id:85739
  • name:Whirlwind
  • tooltip:Your next single-target attack strikes up to {$=}w1 additional targets for {$=}w3% damage.
  • description:Causes your next single-target attack to strike up to {$s1=4} additional targets for {$s3=55}% damage.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Rage of Fyr'alath 3.0 0.0 121.1s 120.3s 1.9s 1.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_rage_of_fyralath
  • max_stacks:50
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 127.2s
  • trigger_min/max:120.0s / 124.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:1.46% / 2.37%

Stack Uptimes

  • rage_of_fyralath_1:1.91%

Spelldata

  • id:417138
  • name:Rage of Fyr'alath
  • tooltip:Explosive Rage damage increased by {$=}w1%.
  • description:{$@spelldesc420248=Your attacks apply Mark of Fyr'alath, dealing {$414532=}o1 Shadowflame damage over {$414532d=15 seconds}. Upon activation, Fyr'alath draws in the flames from all marks to increase its damage by {$s1=10}%.}
  • max_stacks:50
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Reckless Abandon 135.1 0.0 2.2s 2.2s 0.8s 37.44% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_reckless_abandon
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 9.4s
  • trigger_min/max:1.5s / 9.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s
  • uptime_min/max:31.92% / 43.86%

Stack Uptimes

  • reckless_abandon_1:37.44%

Spelldata

  • id:396752
  • name:Reckless Abandon
  • tooltip:Your next Bloodthirst or Raging Blow is greatly empowered.
  • description:{$@spelldesc396749=Recklessness generates {$=}{{$s1=500}/10} Rage and Rampage greatly empowers your next Bloodthirst or Raging Blow.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Recklessness 14.1 0.0 21.5s 21.5s 10.7s 50.18% 57.33% 0.0 (0.0) 13.7

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_recklessness
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 180.5s
  • trigger_min/max:4.0s / 180.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 164.0s
  • uptime_min/max:26.80% / 77.85%

Stack Uptimes

  • recklessness_1:50.18%

Spelldata

  • id:1719
  • name:Recklessness
  • tooltip:Rage generation increased by {$s5=100}%. Critical strike chance of all abilities increased by {$=}w1%.{$?a202751=true}[ Bloodthirst and Raging Blow upgraded to {$@=}spellname335096 and {$@=}spellname335097.][]
  • description:Go berserk, increasing all Rage generation by {$s4=100}% and granting your abilities {$s1=20}% increased critical strike chance for {$d=12 seconds}.{$?a396749=true}[ |cFFFFFFFFGenerates {$=}{{$s3=0}/10} Rage.|r][]
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:0.00%
Roused Shadowflame 9.3 35.4 33.4s 6.6s 26.7s 82.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_roused_shadowflame
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.0s / 76.9s
  • trigger_min/max:3.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.2s
  • uptime_min/max:67.51% / 91.70%

Stack Uptimes

  • roused_shadowflame_1:17.06%
  • roused_shadowflame_2:16.77%
  • roused_shadowflame_3:16.49%
  • roused_shadowflame_4:16.31%
  • roused_shadowflame_5:15.96%

Spelldata

  • id:406887
  • name:Roused Shadowflame
  • tooltip:The Shadowflame stirs, increasing the damage of Roiling Shadowflame by {$=}w1%.
  • description:{$@spelldesc406254=Dealing damage has a chance to rouse the Shadowflame, inflicting {$s2=867} Shadowflame damage upon your target and {$s3=116} Shadowflame damage to yourself. Whenever this happens, you gain a stack of Roused Shadowflame. Roused Shadowflame increases this effects damage by {$s4=20}%, stacking {$406887u=5} times. Upon reaching maximum stacks, the Roused Shadowflame will subside.}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Slaughtering Strikes (_an) 135.3 395.0 2.2s 0.6s 1.6s 71.12% 98.11% 37.0 (37.0) 0.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_slaughtering_strikes_an
  • max_stacks:5
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 9.4s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s
  • uptime_min/max:62.54% / 77.96%

Stack Uptimes

  • slaughtering_strikes_an_1:0.45%
  • slaughtering_strikes_an_2:32.65%
  • slaughtering_strikes_an_3:17.89%
  • slaughtering_strikes_an_4:7.95%
  • slaughtering_strikes_an_5:12.18%

Spelldata

  • id:393943
  • name:Slaughtering Strikes
  • tooltip:Every strike of your next Rampage will deal an additional {$s1=2}% damage.
  • description:{$@spelldesc388004=Raging Blow causes every strike of your next Rampage to deal an additional {$393931s1=20}% damage, stacking up to {$s2=5} times. Annihilator causes every strike of your next Rampage to deal an additional {$393943s1=2}% damage, stacking up to {$s2=5} times. }
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Sophic Devotion 4.3 1.2 61.2s 45.6s 16.5s 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 208.1s
  • trigger_min/max:0.0s / 208.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.0s
  • uptime_min/max:5.09% / 59.80%

Stack Uptimes

  • sophic_devotion_1:23.62%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sudden Death 15.0 3.4 19.4s 15.7s 4.1s 20.08% 0.00% 3.4 (3.4) 1.4

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_sudden_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 76.1s
  • trigger_min/max:0.0s / 71.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.6s
  • uptime_min/max:4.89% / 41.99%

Stack Uptimes

  • sudden_death_1:20.08%

Spelldata

  • id:280776
  • name:Sudden Death
  • tooltip:{$?a317320=false}[Condemn][Execute] can be used on any target, regardless of their health.
  • description:{$@spelldesc280721=Your attacks have a chance to reset the cooldown of {$?a317320=false}[Condemn][Execute] and make it usable on any target, regardless of their health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Wafting Devotion 4.3 1.2 61.3s 45.7s 16.5s 23.57% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 221.6s
  • trigger_min/max:0.0s / 208.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:4.90% / 61.94%

Stack Uptimes

  • wafting_devotion_1:23.57%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Strikes 13.6 14.1 22.4s 10.9s 18.9s 85.56% 0.00% 14.1 (14.1) 12.7

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_wild_strikes
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:8.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 187.9s
  • trigger_min/max:8.0s / 50.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 186.9s
  • uptime_min/max:66.13% / 97.55%

Stack Uptimes

  • wild_strikes_1:85.56%

Spelldata

  • id:382946
  • name:Wild Strikes
  • tooltip:
  • description:Haste increased by {$s1=1}% and your auto-attack critical strikes increase your auto-attack speed by {$s2=10}% for {$392778d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Berserker Stance

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_berserker_stance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:3.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:386196
  • name:Berserker Stance
  • tooltip:Auto-attack damage increased by {$s1=15}% and the effects of Fear, Sap and Incapacitate are reduced by {$s2=10}%.
  • description:An aggressive combat state that increases the damage of your auto-attacks by {$s1=15}% and reduces the duration of Fear, Sap and Incapacitate effects on you by {$s2=10}%. Lasts until canceled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:3.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (thousandbone_tongueslicer)

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_thousandbone_tongueslicer
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382156
  • name:Well Fed
  • tooltip:Critical strike and mastery increased by {$=}w1.
  • description:Increases Critical Strike and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 44.9 20.0 78.0 6.6s 0.9s 106.1s
Windfury (Off Hand) 36.0 14.0 61.0 8.1s 0.9s 99.6s
delayed_aa_channel 0.0 0.0 2.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Rage Cap 5.92% 2.60% 10.41% 0.5s 0.0s 3.8s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Odyn's Fury (_torment)45.45545.00050.288121.71390.000144.551
Avatar0.5800.0015.2881.2180.0009.551
Recklessness0.2800.0010.7040.4710.0001.607
Odyn's Fury0.7300.0016.0026.4310.62519.104
Execute2.6550.00167.32456.97513.721127.240
Thunderous Roar0.6780.0012.3141.6490.0004.801
Bloodbath0.3100.0015.25341.04722.51763.330
Bloodthirst0.0600.0013.4491.7220.0907.752
Storm Bolt60.4430.076190.4907.6930.000190.490

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Estî
AnnihilatorRage530.332926.6026.89%5.52309.029.55%
AvatarRage3.6860.330.55%16.4013.2317.99%
Avatar (_torment)Rage11.18120.151.10%10.7552.3730.35%
BloodbathRage134.701692.5315.55%12.5760.533.45%
BloodthirstRage29.63241.002.21%8.130.010.00%
Charge (_impact)Rage1.0020.000.18%20.000.000.00%
Cold Steel, Hot BloodRage6.8428.170.26%4.120.000.00%
ExecuteRage21.53479.614.41%22.2818.003.62%
Frothing BerserkerRage27.06433.033.98%16.000.000.00%
melee_main_handRage269.602831.3426.02%10.50293.879.40%
melee_off_handRage260.731271.8611.69%4.88239.3815.84%
Odyn's FuryRage11.18223.062.05%19.9635.7313.81%
Odyn's Fury (_torment)Rage3.6856.690.52%15.4153.6448.62%
RecklessnessRage3.73171.351.57%45.9455.7924.56%
SlamRage20.59241.042.21%11.710.010.00%
Thunderous RoarRage3.7039.730.37%10.7334.3046.33%
WhirlwindRage10.7146.720.43%4.360.000.00%
Usage Type Count Total Tot% Avg RPE APR
Estî
RampageRage 135.0610805.19100.00%80.0080.00884.37
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 927280.0 6429.46 6537.90 2642631.2 894748.3 512508.2 927280.0
Rage 0.0 36.28 36.02 1165.9 78.0 0.2 136.0

Statistics & Data Analysis

Fight Length
Estî Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Estî Damage Per Second
Count 9999
Mean 199588.22
Minimum 183618.43
Maximum 223000.78
Spread ( max - min ) 39382.35
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 4687.4955
5th Percentile 192190.07
95th Percentile 207366.43
( 95th Percentile - 5th Percentile ) 15176.37
Mean Distribution
Standard Deviation 46.8773
95.00% Confidence Interval ( 199496.34 - 199680.09 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2119
0.1 Scale Factor Error with Delta=300 187571
0.05 Scale Factor Error with Delta=300 750284
0.01 Scale Factor Error with Delta=300 18757087
Priority Target DPS
Estî Priority Target Damage Per Second
Count 9999
Mean 199588.22
Minimum 183618.43
Maximum 223000.78
Spread ( max - min ) 39382.35
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 4687.4955
5th Percentile 192190.07
95th Percentile 207366.43
( 95th Percentile - 5th Percentile ) 15176.37
Mean Distribution
Standard Deviation 46.8773
95.00% Confidence Interval ( 199496.34 - 199680.09 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2119
0.1 Scale Factor Error with Delta=300 187571
0.05 Scale Factor Error with Delta=300 750284
0.01 Scale Factor Error with Delta=300 18757087
DPS(e)
Estî Damage Per Second (Effective)
Count 9999
Mean 199588.22
Minimum 183618.43
Maximum 223000.78
Spread ( max - min ) 39382.35
Range [ ( max - min ) / 2 * 100% ] 9.87%
Damage
Estî Damage
Count 9999
Mean 59849940.84
Minimum 44876904.99
Maximum 74264567.52
Spread ( max - min ) 29387662.54
Range [ ( max - min ) / 2 * 100% ] 24.55%
DTPS
Estî Damage Taken Per Second
Count 9999
Mean 6514.18
Minimum 2147.24
Maximum 11658.32
Spread ( max - min ) 9511.08
Range [ ( max - min ) / 2 * 100% ] 73.00%
HPS
Estî Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Estî Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Estî Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Estî Healing Taken Per Second
Count 9999
Mean 6402.88
Minimum 2132.50
Maximum 11647.23
Spread ( max - min ) 9514.73
Range [ ( max - min ) / 2 * 100% ] 74.30%
TMI
Estî Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
EstîTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Estî Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%cooldown.avatar.duration=0|trinket.1.cooldown.duration%%cooldown.odyns_fury.duration=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%cooldown.avatar.duration=0|trinket.2.cooldown.duration%%cooldown.odyns_fury.duration=0)
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 use_item,name=algethar_puzzle_box
E 0.00 berserker_stance,toggle=on
F 0.00 avatar,if=!talent.titans_torment
G 0.00 recklessness,if=!talent.reckless_abandon
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 1.00 charge,if=time<=0.5|movement.distance>5
0.00 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)
J 1.50 potion
0.00 pummel,if=target.debuff.casting.react
K 0.00 call_action_list,name=trinkets
0.00 ravager,if=cooldown.recklessness.remains<3|buff.recklessness.up
0.00 lights_judgment,if=buff.recklessness.down
0.00 berserking,if=buff.recklessness.up
0.00 blood_fury
0.00 fireblood
0.00 ancestral_call
0.00 invoke_external_buff,name=power_infusion,if=buff.avatar.remains>15&fight_remains>=135|(target.health.pct<35&talent.massacre|target.health.pct<20)&buff.avatar.up|fight_remains<=25
L 3.68 avatar,if=talent.titans_torment&buff.enrage.up&raid_event.adds.in>15&!buff.avatar.up&cooldown.odyns_fury.remains|talent.berserkers_torment&buff.enrage.up&!buff.avatar.up&raid_event.adds.in>15|!talent.titans_torment&!talent.berserkers_torment&(buff.recklessness.up|target.time_to_die<20)
M 3.73 recklessness,if=!raid_event.adds.exists&(talent.annihilator&cooldown.champions_spear.remains<1|cooldown.avatar.remains>40|!talent.avatar|target.time_to_die<12)
0.00 recklessness,if=!raid_event.adds.exists&!talent.annihilator|target.time_to_die<12
0.00 champions_spear,if=buff.enrage.up&((buff.furious_bloodthirst.up&talent.titans_torment)|!talent.titans_torment|target.time_to_die<20|active_enemies>1|!set_bonus.tier31_2pc)&raid_event.adds.in>15
N 0.00 run_action_list,name=multi_target,if=active_enemies>=2
O 0.00 run_action_list,name=single_target,if=active_enemies=1
actions.single_target
# count action,conditions
0.00 whirlwind,if=spell_targets.whirlwind>1&talent.improved_whirlwind&!buff.meat_cleaver.up|raid_event.adds.in<2&talent.improved_whirlwind&!buff.meat_cleaver.up
0.00 execute,if=buff.ashen_juggernaut.up&buff.ashen_juggernaut.remains<gcd
P 11.18 odyns_fury,if=(buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)&(talent.dancing_blades&buff.dancing_blades.remains<5|!talent.dancing_blades))
0.00 rampage,if=talent.anger_management&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
0.00 bloodbath,if=set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95
0.00 bloodthirst,if=(set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95)|(!talent.reckless_abandon&buff.furious_bloodthirst.up&buff.enrage.up&(!dot.gushing_wound.remains|buff.champions_might.up))
Q 134.70 bloodbath,if=set_bonus.tier31_2pc
R 3.70 thunderous_roar,if=buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)
0.00 onslaught,if=buff.enrage.up|talent.tenderize
0.00 crushing_blow,if=talent.wrath_and_fury&buff.enrage.up&!buff.furious_bloodthirst.up
S 0.81 execute,if=buff.enrage.up&!buff.furious_bloodthirst.up&buff.ashen_juggernaut.up|buff.sudden_death.remains<=gcd&(target.health.pct>35&talent.massacre|target.health.pct>20)
T 110.03 rampage,if=talent.reckless_abandon&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
U 20.60 execute,if=buff.enrage.up
0.00 rampage,if=talent.anger_management
V 0.11 execute
0.00 bloodbath,if=buff.enrage.up&talent.reckless_abandon&!talent.wrath_and_fury
0.00 rampage,if=target.health.pct<35&talent.massacre.enabled
W 28.22 bloodthirst,if=(buff.enrage.down|(talent.annihilator&!buff.recklessness.up))&!buff.furious_bloodthirst.up
0.00 raging_blow,if=charges>1&talent.wrath_and_fury
0.00 crushing_blow,if=charges>1&talent.wrath_and_fury&!buff.furious_bloodthirst.up
0.00 bloodbath,if=buff.enrage.down|!talent.wrath_and_fury
0.00 crushing_blow,if=buff.enrage.up&talent.reckless_abandon&!buff.furious_bloodthirst.up
X 0.33 bloodthirst,if=!talent.wrath_and_fury&!buff.furious_bloodthirst.up
0.00 raging_blow,if=charges>1
Y 25.04 rampage
Z 20.59 slam,if=talent.annihilator
0.00 bloodbath
0.00 raging_blow
0.00 crushing_blow,if=!buff.furious_bloodthirst.up
a 1.09 bloodthirst
b 10.71 whirlwind
0.00 wrecking_throw
c 0.62 storm_bolt
actions.trinkets
# count action,conditions
d 2.98 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.avatar.up
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.recklessness.remains<3|(talent.anger_management&cooldown.avatar.remains<3)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.avatar.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.avatar.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.avatar.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.avatar.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.avatar.up|!trinket.1.cast_time>0)|cooldown.avatar.remains_expected>20)
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.avatar.up|!trinket.2.cast_time>0)|cooldown.avatar.remains_expected>20)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCEHIJdMTPQRTQTLQTQTQTQTQTQTQTQTQTQPTQTQTQTQTQTQUTQZWYQbWYQYQZWTQUTQTQUWTQPYQZYQbaYQUWTQZWYQbWYQTQZTQTQTQYQZWbTQPYQZaYQbWTQYQMTQRTQTLQTQTQTQTQPTQTQTQTQUTQTQTQZUTQUdTQUTQZWUTQPTQZYQbYQZWTQbWTQZWUTQbWYQZWYQTQZTQYQUWYQZWTQbWPTQYQZYQbWYQZWTMQTQRTQLTQTQTQTQPTQTQTQUTQYQZWTQUTQTQTQTQTQTQTQUTQYPQUYQZYQbWYQYQZWTQbWZTQUWdTQUUTQYQUPTQUYQZUTQbUTQYQUWYQUWTQUWMTQTQRTLQTQTQTQPTQTQTQTQTQTQTQTQTQUW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Estî 0.0/136: 0% rage
Pre precombat 1 food Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 2 augmentation Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 4 trinket_1_exclude Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 5 trinket_2_exclude Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 6 trinket_1_sync Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 7 trinket_2_sync Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 8 trinket_1_buffs Estî 0.0/136: 0% rage corrupting_rage
Pre precombat 9 trinket_2_buffs Estî 0.0/136: 0% rage corrupting_rage
Pre precombat A trinket_priority Estî 0.0/136: 0% rage corrupting_rage
Pre precombat B trinket_1_manual Estî 0.0/136: 0% rage corrupting_rage
Pre precombat C trinket_2_manual Estî 0.0/136: 0% rage corrupting_rage
Pre precombat E berserker_stance Estî 0.0/136: 0% rage corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/136: 0% rage corrupting_rage
0:00.000 default I charge Fluffy_Pillow 19.4/136: 14% rage bloodlust, wild_strikes, slaughtering_strikes_an(2), corrupting_rage
0:00.000 default J potion Fluffy_Pillow 39.4/136: 29% rage bloodlust, wild_strikes, slaughtering_strikes_an(2), corrupting_rage
0:00.000 trinkets d use_item_fyralath_the_dreamrender Fluffy_Pillow 39.4/136: 29% rage bloodlust, wild_strikes, slaughtering_strikes_an(2), corrupting_rage, elemental_potion_of_ultimate_power
0:01.915 default M recklessness Estî 39.4/136: 29% rage bloodlust, wild_strikes, slaughtering_strikes_an(2), corrupting_rage, elemental_potion_of_ultimate_power
0:01.915 single_target T rampage Fluffy_Pillow 89.4/136: 66% rage bloodlust, wild_strikes, recklessness, slaughtering_strikes_an(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.691 single_target P odyns_fury Fluffy_Pillow 9.4/136: 7% rage bloodlust, wild_strikes, enrage, frenzy, recklessness, reckless_abandon, roused_shadowflame, corrupting_rage, elemental_potion_of_ultimate_power
0:03.446 single_target Q bloodbath Fluffy_Pillow 121.4/136: 89% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy, recklessness, reckless_abandon, slaughtering_strikes_an(3), furious_bloodthirst(3), roused_shadowflame, corrupting_rage, elemental_potion_of_ultimate_power
0:04.200 single_target R thunderous_roar Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy, recklessness, slaughtering_strikes_an(5), furious_bloodthirst(2), roused_shadowflame, firestarter, corrupting_rage, elemental_potion_of_ultimate_power
0:04.953 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy, recklessness, slaughtering_strikes_an(5), furious_bloodthirst(2), roused_shadowflame, firestarter(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.708 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(2), recklessness, reckless_abandon, furious_bloodthirst(2), roused_shadowflame(2), firestarter(3), corrupting_rage, elemental_potion_of_ultimate_power
0:06.463 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(2), recklessness, slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(2), firestarter(3), corrupting_rage, elemental_potion_of_ultimate_power
0:07.218 default L avatar Estî 85.6/136: 63% rage bloodlust, wild_strikes, dancing_blades, enrage, frenzy(3), recklessness, reckless_abandon, furious_bloodthirst, roused_shadowflame(2), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:07.218 single_target Q bloodbath Fluffy_Pillow 135.6/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(3), recklessness, reckless_abandon, furious_bloodthirst(4), roused_shadowflame(2), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:07.973 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(3), recklessness, sudden_death, slaughtering_strikes_an(3), furious_bloodthirst(3), roused_shadowflame(2), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:08.728 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(3), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:09.483 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(4), furious_bloodthirst(2), roused_shadowflame(3), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:10.237 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst(2), roused_shadowflame(3), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:10.993 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(3), firestarter(4), corrupting_rage, elemental_potion_of_ultimate_power
0:11.748 single_target Q bloodbath Fluffy_Pillow 85.2/136: 63% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst, roused_shadowflame(3), firestarter(4), elemental_potion_of_ultimate_power
0:12.503 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(4), elemental_potion_of_ultimate_power
0:13.258 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(4), elemental_potion_of_ultimate_power
0:14.013 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(5), roused_shadowflame(3), firestarter(4), elemental_potion_of_ultimate_power
0:14.767 single_target Q bloodbath Fluffy_Pillow 72.0/136: 53% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(3), firestarter(4), elemental_potion_of_ultimate_power
0:15.521 single_target T rampage Fluffy_Pillow 126.8/136: 93% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(4), elemental_potion_of_ultimate_power
0:16.275 single_target Q bloodbath Fluffy_Pillow 101.6/136: 75% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(4), firestarter(4), elemental_potion_of_ultimate_power
0:17.031 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(4), elemental_potion_of_ultimate_power
0:17.786 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(4), elemental_potion_of_ultimate_power
0:18.540 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(4), elemental_potion_of_ultimate_power
0:19.295 single_target Q bloodbath Fluffy_Pillow 69.6/136: 51% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(5), firestarter(4), elemental_potion_of_ultimate_power
0:20.048 single_target T rampage Fluffy_Pillow 124.4/136: 91% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(4), elemental_potion_of_ultimate_power
0:20.803 single_target Q bloodbath Fluffy_Pillow 122.4/136: 90% rage bloodlust, avatar, wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(5), firestarter(5), elemental_potion_of_ultimate_power
0:21.558 single_target P odyns_fury Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, enrage, frenzy(4), recklessness, sudden_death, roused_shadowflame(5), firestarter(5), elemental_potion_of_ultimate_power
0:22.313 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(3), firestarter(5), elemental_potion_of_ultimate_power
0:23.067 single_target Q bloodbath Fluffy_Pillow 118.0/136: 87% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst(3), firestarter(5), elemental_potion_of_ultimate_power
0:23.822 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(2), firestarter(5), elemental_potion_of_ultimate_power
0:24.577 single_target Q bloodbath Fluffy_Pillow 118.0/136: 87% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(3), furious_bloodthirst(2), firestarter(6), elemental_potion_of_ultimate_power
0:25.332 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(5), furious_bloodthirst, firestarter(6), elemental_potion_of_ultimate_power
0:26.087 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst, firestarter(6), corrupting_rage, elemental_potion_of_ultimate_power
0:26.842 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage bloodlust, avatar, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), firestarter(6), corrupting_rage, elemental_potion_of_ultimate_power
0:27.595 single_target Q bloodbath Fluffy_Pillow 85.6/136: 63% rage bloodlust, avatar, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, firestarter(6), corrupting_rage, elemental_potion_of_ultimate_power
0:28.349 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), firestarter(6), corrupting_rage, elemental_potion_of_ultimate_power
0:29.103 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, firestarter(6), corrupting_rage, elemental_potion_of_ultimate_power
0:29.858 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame, firestarter(7), corrupting_rage, elemental_potion_of_ultimate_power
0:30.613 single_target Q bloodbath Fluffy_Pillow 50.2/136: 37% rage bloodlust, avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, sudden_death, roused_shadowflame, firestarter(7), corrupting_rage
0:31.367 single_target U execute Fluffy_Pillow 77.6/136: 57% rage bloodlust, wild_strikes, dancing_blades, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(2), roused_shadowflame, firestarter(7), corrupting_rage
0:32.122 single_target T rampage Fluffy_Pillow 117.0/136: 86% rage bloodlust, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(7), corrupting_rage
0:32.877 single_target Q bloodbath Fluffy_Pillow 37.0/136: 27% rage bloodlust, wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(7), corrupting_rage
0:33.631 single_target Z slam Fluffy_Pillow 64.4/136: 47% rage bloodlust, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(7), corrupting_rage
0:34.385 single_target W bloodthirst Fluffy_Pillow 93.8/136: 69% rage bloodlust, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(7), corrupting_rage
0:35.140 single_target Y rampage Fluffy_Pillow 101.8/136: 75% rage bloodlust, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(7), corrupting_rage
0:35.893 single_target Q bloodbath Fluffy_Pillow 49.0/136: 36% rage bloodlust, wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(7), corrupting_rage
0:36.648 single_target b whirlwind Fluffy_Pillow 57.0/136: 42% rage bloodlust, wild_strikes, enrage, frenzy(4), roused_shadowflame, firestarter(7), corrupting_rage
0:37.402 single_target W bloodthirst Fluffy_Pillow 88.2/136: 65% rage bloodlust, wild_strikes, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(7), corrupting_rage
0:38.157 single_target Y rampage Fluffy_Pillow 115.6/136: 85% rage bloodlust, wild_strikes, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame, firestarter(7), corrupting_rage
0:38.913 single_target Q bloodbath Fluffy_Pillow 51.6/136: 38% rage bloodlust, wild_strikes, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame(2), firestarter(7), corrupting_rage
0:39.669 single_target Y rampage Fluffy_Pillow 86.8/136: 64% rage bloodlust, wild_strikes, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(7), corrupting_rage
0:40.423 single_target Q bloodbath Fluffy_Pillow 50.0/136: 37% rage wild_strikes, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(7), corrupting_rage
0:41.239 single_target Z slam Fluffy_Pillow 58.0/136: 43% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(7), corrupting_rage
0:42.054 single_target W bloodthirst Fluffy_Pillow 87.4/136: 64% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(8), corrupting_rage
0:42.868 single_target T rampage Fluffy_Pillow 95.4/136: 70% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(8), sophic_devotion, corrupting_rage
0:43.683 single_target Q bloodbath Fluffy_Pillow 54.2/136: 40% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(8), sophic_devotion, corrupting_rage
0:44.498 single_target U execute Fluffy_Pillow 70.2/136: 52% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(8), sophic_devotion, corrupting_rage
0:45.312 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame(3), firestarter(8), sophic_devotion, corrupting_rage
0:46.129 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(3), firestarter(8), sophic_devotion, corrupting_rage
0:46.942 single_target T rampage Fluffy_Pillow 126.4/136: 93% rage enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(8), sophic_devotion, corrupting_rage
0:47.755 single_target Q bloodbath Fluffy_Pillow 46.4/136: 34% rage enrage, frenzy(4), reckless_abandon, sudden_death, roused_shadowflame(3), firestarter(8), sophic_devotion
0:48.568 single_target U execute Fluffy_Pillow 73.8/136: 54% rage enrage, frenzy(4), sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(8), sophic_devotion
0:49.384 single_target W bloodthirst Fluffy_Pillow 93.8/136: 69% rage enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(8), sophic_devotion
0:50.199 single_target T rampage Fluffy_Pillow 101.8/136: 75% rage enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(8), sophic_devotion
0:51.013 single_target Q bloodbath Fluffy_Pillow 41.2/136: 30% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(4), firestarter(8), wafting_devotion, sophic_devotion
0:51.783 single_target P odyns_fury Fluffy_Pillow 76.4/136: 56% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:52.554 single_target Y rampage Fluffy_Pillow 101.4/136: 75% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), furious_bloodthirst(3), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:53.324 single_target Q bloodbath Fluffy_Pillow 52.4/136: 39% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(3), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:54.096 single_target Z slam Fluffy_Pillow 79.8/136: 59% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:54.867 single_target Y rampage Fluffy_Pillow 89.8/136: 66% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:55.640 single_target Q bloodbath Fluffy_Pillow 29.2/136: 21% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(2), roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:56.411 single_target b whirlwind Fluffy_Pillow 56.6/136: 42% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:57.182 single_target a bloodthirst Fluffy_Pillow 60.6/136: 45% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(5), firestarter(8), wafting_devotion, sophic_devotion
0:57.955 single_target Y rampage Fluffy_Pillow 99.8/136: 73% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(8), wafting_devotion
0:58.726 single_target Q bloodbath Fluffy_Pillow 39.2/136: 29% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(8), wafting_devotion
0:59.497 single_target U execute Fluffy_Pillow 47.2/136: 35% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(8), wafting_devotion
1:00.267 single_target W bloodthirst Fluffy_Pillow 86.6/136: 64% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame(5), firestarter(8), wafting_devotion
1:01.039 single_target T rampage Fluffy_Pillow 121.8/136: 90% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(8), wafting_devotion
1:01.811 single_target Q bloodbath Fluffy_Pillow 41.8/136: 31% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(5), firestarter(8), wafting_devotion
1:02.583 single_target Z slam Fluffy_Pillow 69.2/136: 51% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(8), wafting_devotion, corrupting_rage
1:03.353 single_target W bloodthirst Fluffy_Pillow 106.4/136: 78% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(8), wafting_devotion, corrupting_rage
1:04.125 single_target Y rampage Fluffy_Pillow 114.4/136: 84% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(8), wafting_devotion, corrupting_rage
1:04.897 single_target Q bloodbath Fluffy_Pillow 65.4/136: 48% rage wild_strikes, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(3), firestarter(8), wafting_devotion, corrupting_rage
1:05.669 single_target b whirlwind Fluffy_Pillow 73.4/136: 54% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), firestarter(8), wafting_devotion, corrupting_rage
1:06.440 single_target W bloodthirst Fluffy_Pillow 96.8/136: 71% rage wild_strikes, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(5), firestarter(8), wafting_devotion, corrupting_rage
1:07.212 single_target Y rampage Fluffy_Pillow 104.8/136: 77% rage wild_strikes, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), firestarter(9), wafting_devotion, corrupting_rage
1:07.983 single_target Q bloodbath Fluffy_Pillow 86.8/136: 64% rage wild_strikes, enrage, frenzy(4), meat_cleaver(2), recklessness, reckless_abandon, slaughtering_strikes_an, firestarter(10), wafting_devotion, corrupting_rage
1:08.756 single_target T rampage Fluffy_Pillow 102.8/136: 76% rage wild_strikes, enrage, frenzy(4), meat_cleaver, recklessness, slaughtering_strikes_an, firestarter(10), wafting_devotion, corrupting_rage
1:09.527 single_target Q bloodbath Fluffy_Pillow 61.6/136: 45% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, firestarter(10), wafting_devotion, corrupting_rage
1:10.300 single_target Z slam Fluffy_Pillow 77.6/136: 57% rage wild_strikes, enrage, frenzy(4), recklessness, firestarter(10), wafting_devotion, corrupting_rage
1:11.073 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame, firestarter(10), wafting_devotion, corrupting_rage
1:11.843 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(11), wafting_devotion, corrupting_rage
1:12.615 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame, firestarter(11), wafting_devotion, corrupting_rage
1:13.388 single_target Q bloodbath Fluffy_Pillow 30.8/136: 23% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(11), wafting_devotion, corrupting_rage
1:14.160 single_target T rampage Fluffy_Pillow 108.8/136: 80% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame, firestarter(11), wafting_devotion, corrupting_rage
1:14.931 single_target Q bloodbath Fluffy_Pillow 28.8/136: 21% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(11), corrupting_rage
1:15.761 single_target Y rampage Fluffy_Pillow 83.6/136: 61% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(11), corrupting_rage
1:16.576 single_target Q bloodbath Fluffy_Pillow 3.6/136: 3% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(11), corrupting_rage
1:17.392 single_target Z slam Fluffy_Pillow 42.6/136: 31% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(11), corrupting_rage
1:18.207 single_target W bloodthirst Fluffy_Pillow 52.6/136: 39% rage enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(11), corrupting_rage
1:19.023 single_target b whirlwind Fluffy_Pillow 80.0/136: 59% rage enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(11), corrupting_rage
1:19.838 single_target T rampage Fluffy_Pillow 84.0/136: 62% rage frenzy(4), meat_cleaver(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(11), corrupting_rage
1:20.776 single_target Q bloodbath Fluffy_Pillow 23.4/136: 17% rage enrage, frenzy(4), meat_cleaver(3), reckless_abandon, roused_shadowflame(2), firestarter(11), corrupting_rage
1:21.593 single_target P odyns_fury Fluffy_Pillow 31.4/136: 23% rage enrage, frenzy(4), meat_cleaver(2), roused_shadowflame(3), firestarter(11), corrupting_rage
1:22.595 single_target Y rampage Fluffy_Pillow 87.4/136: 64% rage avatar, dancing_blades, enrage, frenzy(4), meat_cleaver(2), slaughtering_strikes_an(3), furious_bloodthirst(3), roused_shadowflame(3), firestarter(11), corrupting_rage
1:23.409 single_target Q bloodbath Fluffy_Pillow 34.6/136: 25% rage avatar, dancing_blades, enrage, frenzy(4), meat_cleaver, reckless_abandon, slaughtering_strikes_an(3), furious_bloodthirst(3), roused_shadowflame(3), firestarter(11), corrupting_rage
1:24.222 single_target Z slam Fluffy_Pillow 42.6/136: 31% rage avatar, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), furious_bloodthirst(2), roused_shadowflame(3), firestarter(11), corrupting_rage
1:25.035 single_target a bloodthirst Fluffy_Pillow 79.8/136: 59% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), furious_bloodthirst(2), roused_shadowflame(3), firestarter(11), corrupting_rage
1:25.848 single_target Y rampage Fluffy_Pillow 91.8/136: 67% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), furious_bloodthirst, roused_shadowflame(3), firestarter(11), corrupting_rage
1:26.664 single_target Q bloodbath Fluffy_Pillow 42.8/136: 31% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst, roused_shadowflame(3), firestarter(11), corrupting_rage
1:27.478 single_target b whirlwind Fluffy_Pillow 70.2/136: 52% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(11), corrupting_rage
1:28.291 single_target W bloodthirst Fluffy_Pillow 74.2/136: 55% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(11), corrupting_rage
1:29.106 single_target T rampage Fluffy_Pillow 117.2/136: 86% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame(3), firestarter(11), corrupting_rage
1:29.922 single_target Q bloodbath Fluffy_Pillow 72.6/136: 53% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame(3), firestarter(11), corrupting_rage
1:30.736 single_target Y rampage Fluffy_Pillow 111.6/136: 82% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(11), corrupting_rage
1:31.550 single_target Q bloodbath Fluffy_Pillow 31.6/136: 23% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, roused_shadowflame(4), firestarter(11), corrupting_rage
1:32.365 default M recklessness Estî 66.8/136: 49% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(11), corrupting_rage
1:32.365 single_target T rampage Fluffy_Pillow 116.8/136: 86% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(11), corrupting_rage
1:33.179 single_target Q bloodbath Fluffy_Pillow 52.8/136: 39% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(4), firestarter(11), corrupting_rage
1:33.994 single_target R thunderous_roar Fluffy_Pillow 107.6/136: 79% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(12), corrupting_rage
1:35.015 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame(5), firestarter(12), corrupting_rage
1:35.831 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(5), firestarter(12), corrupting_rage
1:36.646 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(12), corrupting_rage
1:37.461 default L avatar Estî 30.8/136: 23% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, firestarter(12), corrupting_rage
1:37.461 single_target Q bloodbath Fluffy_Pillow 80.8/136: 59% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(3), firestarter(13), corrupting_rage
1:38.278 single_target T rampage Fluffy_Pillow 135.6/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), furious_bloodthirst(2), firestarter(13), corrupting_rage
1:39.093 single_target Q bloodbath Fluffy_Pillow 102.0/136: 75% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(2), furious_bloodthirst(2), firestarter(13), corrupting_rage
1:39.908 single_target T rampage Fluffy_Pillow 133.6/136: 98% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), furious_bloodthirst, firestarter(13), corrupting_rage
1:40.725 single_target Q bloodbath Fluffy_Pillow 108.4/136: 80% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst, firestarter(13), corrupting_rage
1:41.542 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), firestarter(13), corrupting_rage
1:42.356 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, firestarter(13), corrupting_rage
1:43.170 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), firestarter(13), corrupting_rage
1:43.984 single_target Q bloodbath Fluffy_Pillow 69.6/136: 51% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), firestarter(13), corrupting_rage
1:44.798 single_target P odyns_fury Fluffy_Pillow 85.6/136: 63% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), firestarter(13), corrupting_rage
1:45.612 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(4), furious_bloodthirst(3), firestarter(13), corrupting_rage
1:46.425 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(3), firestarter(13), corrupting_rage
1:47.239 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(2), firestarter(13), corrupting_rage
1:48.053 single_target Q bloodbath Fluffy_Pillow 69.6/136: 51% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst(2), firestarter(13), corrupting_rage
1:48.867 single_target T rampage Fluffy_Pillow 124.4/136: 91% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst, firestarter(13), corrupting_rage
1:49.680 single_target Q bloodbath Fluffy_Pillow 44.4/136: 33% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst, firestarter(13), corrupting_rage
1:50.495 single_target T rampage Fluffy_Pillow 99.2/136: 73% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), firestarter(13), corrupting_rage
1:51.310 single_target Q bloodbath Fluffy_Pillow 58.0/136: 43% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame, firestarter(13), corrupting_rage
1:52.125 single_target U execute Fluffy_Pillow 74.0/136: 54% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, roused_shadowflame, firestarter(13), corrupting_rage
1:52.941 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame, firestarter(13), corrupting_rage
1:53.755 single_target Q bloodbath Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(13), corrupting_rage
1:54.569 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame, firestarter(13), corrupting_rage
1:55.382 single_target Q bloodbath Fluffy_Pillow 72.0/136: 53% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(13), corrupting_rage
1:56.195 single_target T rampage Fluffy_Pillow 126.8/136: 93% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame, firestarter(13), corrupting_rage
1:57.010 single_target Q bloodbath Fluffy_Pillow 66.2/136: 49% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(2), roused_shadowflame, firestarter(13), corrupting_rage
1:57.825 single_target Z slam Fluffy_Pillow 74.2/136: 55% rage avatar, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(13), corrupting_rage
1:58.637 single_target U execute Fluffy_Pillow 103.6/136: 76% rage avatar, wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(4), roused_shadowflame, firestarter(13), corrupting_rage
1:59.451 single_target T rampage Fluffy_Pillow 123.6/136: 91% rage avatar, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(13), corrupting_rage
2:00.267 single_target Q bloodbath Fluffy_Pillow 63.0/136: 46% rage avatar, wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(2), firestarter(13), corrupting_rage
2:01.085 single_target U execute Fluffy_Pillow 71.0/136: 52% rage avatar, wild_strikes, enrage, frenzy(4), sudden_death, roused_shadowflame(2), firestarter(13), corrupting_rage
2:01.899 trinkets d use_item_fyralath_the_dreamrender Fluffy_Pillow 122.0/136: 90% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(13), corrupting_rage
2:04.254 single_target T rampage Fluffy_Pillow 122.0/136: 90% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(13), corrupting_rage
2:05.071 single_target Q bloodbath Fluffy_Pillow 69.2/136: 51% rage wild_strikes, enrage, frenzy(4), reckless_abandon, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(14), corrupting_rage
2:05.884 single_target U execute Fluffy_Pillow 77.2/136: 57% rage wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(14), corrupting_rage
2:06.699 single_target T rampage Fluffy_Pillow 124.4/136: 91% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(14), corrupting_rage
2:07.513 single_target Q bloodbath Fluffy_Pillow 44.4/136: 33% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(3), firestarter(15), corrupting_rage
2:08.326 single_target Z slam Fluffy_Pillow 71.8/136: 53% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), corrupting_rage
2:09.141 single_target W bloodthirst Fluffy_Pillow 81.8/136: 60% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), corrupting_rage
2:09.957 single_target U execute Fluffy_Pillow 109.2/136: 80% rage wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(4), roused_shadowflame(3), firestarter(15), corrupting_rage
2:10.772 single_target T rampage Fluffy_Pillow 129.2/136: 95% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame(3), firestarter(15), corrupting_rage
2:11.586 single_target Q bloodbath Fluffy_Pillow 68.6/136: 50% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(4), firestarter(15), corrupting_rage
2:12.400 single_target P odyns_fury Fluffy_Pillow 76.6/136: 56% rage wild_strikes, enrage, frenzy(4), roused_shadowflame(4), firestarter(15), corrupting_rage
2:13.214 single_target T rampage Fluffy_Pillow 121.0/136: 89% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(4), firestarter(15), corrupting_rage
2:14.027 single_target Q bloodbath Fluffy_Pillow 60.4/136: 44% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(4), firestarter(15), corrupting_rage
2:14.841 single_target Z slam Fluffy_Pillow 68.4/136: 50% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), corrupting_rage
2:15.656 single_target Y rampage Fluffy_Pillow 97.8/136: 72% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(4), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), corrupting_rage
2:16.471 single_target Q bloodbath Fluffy_Pillow 37.2/136: 27% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), corrupting_rage
2:17.285 single_target b whirlwind Fluffy_Pillow 45.2/136: 33% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(4), firestarter(15)
2:18.098 single_target Y rampage Fluffy_Pillow 80.2/136: 59% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(5), furious_bloodthirst, roused_shadowflame(4), firestarter(15)
2:18.913 single_target Q bloodbath Fluffy_Pillow 19.6/136: 14% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), reckless_abandon, furious_bloodthirst, roused_shadowflame(4), firestarter(15)
2:19.725 single_target Z slam Fluffy_Pillow 27.6/136: 20% rage dancing_blades, enrage, frenzy(4), meat_cleaver(2), roused_shadowflame(4), firestarter(15)
2:20.539 single_target W bloodthirst Fluffy_Pillow 57.0/136: 42% rage dancing_blades, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15)
2:21.351 single_target T rampage Fluffy_Pillow 92.2/136: 68% rage dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(4), firestarter(15)
2:22.167 single_target Q bloodbath Fluffy_Pillow 28.2/136: 21% rage dancing_blades, enrage, frenzy(4), reckless_abandon, roused_shadowflame(4), firestarter(15)
2:22.982 single_target b whirlwind Fluffy_Pillow 67.2/136: 49% rage enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15)
2:23.796 single_target W bloodthirst Fluffy_Pillow 71.2/136: 52% rage enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15)
2:24.611 single_target T rampage Fluffy_Pillow 98.6/136: 72% rage enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(15)
2:25.424 single_target Q bloodbath Fluffy_Pillow 18.6/136: 14% rage enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame(5), firestarter(15)
2:26.241 single_target Z slam Fluffy_Pillow 26.6/136: 20% rage enrage, frenzy(4), meat_cleaver, roused_shadowflame(5), firestarter(15)
2:27.055 single_target W bloodthirst Fluffy_Pillow 67.6/136: 50% rage enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion
2:27.825 single_target U execute Fluffy_Pillow 75.6/136: 56% rage enrage, frenzy(4), sudden_death, slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion
2:28.597 single_target T rampage Fluffy_Pillow 115.0/136: 85% rage enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(15), wafting_devotion
2:29.369 single_target Q bloodbath Fluffy_Pillow 35.0/136: 26% rage enrage, frenzy(4), reckless_abandon, roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:30.141 single_target b whirlwind Fluffy_Pillow 70.2/136: 52% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:30.912 single_target W bloodthirst Fluffy_Pillow 74.2/136: 55% rage wild_strikes, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:31.684 single_target Y rampage Fluffy_Pillow 101.6/136: 75% rage wild_strikes, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:32.457 single_target Q bloodbath Fluffy_Pillow 21.6/136: 16% rage wild_strikes, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:33.226 single_target Z slam Fluffy_Pillow 60.6/136: 45% rage wild_strikes, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:33.998 single_target W bloodthirst Fluffy_Pillow 70.6/136: 52% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:34.770 single_target Y rampage Fluffy_Pillow 105.8/136: 78% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:35.541 single_target Q bloodbath Fluffy_Pillow 25.8/136: 19% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:36.311 single_target T rampage Fluffy_Pillow 80.6/136: 59% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
2:37.081 single_target Q bloodbath Fluffy_Pillow 0.6/136: 0% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, firestarter(15), wafting_devotion, sophic_devotion
2:37.852 single_target Z slam Fluffy_Pillow 78.6/136: 58% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), firestarter(15), wafting_devotion, sophic_devotion
2:38.624 single_target T rampage Fluffy_Pillow 98.6/136: 72% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), firestarter(15), wafting_devotion, sophic_devotion
2:39.394 single_target Q bloodbath Fluffy_Pillow 73.4/136: 54% rage wild_strikes, enrage, frenzy(4), reckless_abandon, firestarter(15), wafting_devotion, sophic_devotion
2:40.166 single_target Y rampage Fluffy_Pillow 81.4/136: 60% rage enrage, frenzy(4), firestarter(15), wafting_devotion, sophic_devotion
2:40.937 single_target Q bloodbath Fluffy_Pillow 32.4/136: 24% rage enrage, frenzy(4), reckless_abandon, sudden_death, firestarter(15), wafting_devotion, sophic_devotion
2:41.708 single_target U execute Fluffy_Pillow 40.4/136: 30% rage enrage, frenzy(4), sudden_death, firestarter(15), wafting_devotion, sophic_devotion
2:42.480 single_target W bloodthirst Fluffy_Pillow 79.8/136: 59% rage enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15), sophic_devotion
2:43.322 single_target Y rampage Fluffy_Pillow 87.8/136: 65% rage enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15), sophic_devotion
2:44.137 single_target Q bloodbath Fluffy_Pillow 38.8/136: 29% rage wild_strikes, enrage, frenzy(4), reckless_abandon, firestarter(15)
2:44.951 single_target Z slam Fluffy_Pillow 46.8/136: 34% rage wild_strikes, enrage, frenzy(4), firestarter(15)
2:45.766 single_target W bloodthirst Fluffy_Pillow 76.2/136: 56% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15)
2:46.581 single_target T rampage Fluffy_Pillow 84.2/136: 62% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15)
2:47.396 single_target Q bloodbath Fluffy_Pillow 51.2/136: 38% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(15), corrupting_rage
2:48.210 single_target b whirlwind Fluffy_Pillow 59.2/136: 44% rage wild_strikes, enrage, frenzy(4), roused_shadowflame, firestarter(15), corrupting_rage
2:49.023 single_target W bloodthirst Fluffy_Pillow 94.2/136: 69% rage wild_strikes, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
2:49.839 single_target P odyns_fury Fluffy_Pillow 102.2/136: 75% rage wild_strikes, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
2:50.713 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), furious_bloodthirst(3), roused_shadowflame, firestarter(15), corrupting_rage
2:51.647 single_target Q bloodbath Fluffy_Pillow 87.0/136: 64% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, furious_bloodthirst(3), roused_shadowflame, firestarter(15), corrupting_rage
2:52.462 single_target Y rampage Fluffy_Pillow 114.4/136: 84% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame, firestarter(15), corrupting_rage
2:53.275 single_target Q bloodbath Fluffy_Pillow 34.4/136: 25% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(2), roused_shadowflame, firestarter(15), corrupting_rage
2:54.089 single_target Z slam Fluffy_Pillow 73.4/136: 54% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), furious_bloodthirst, roused_shadowflame(2), firestarter(15), corrupting_rage
2:54.902 single_target Y rampage Fluffy_Pillow 102.8/136: 76% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), furious_bloodthirst, roused_shadowflame(2), firestarter(15), corrupting_rage
2:55.716 single_target Q bloodbath Fluffy_Pillow 22.8/136: 17% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst, roused_shadowflame(2), firestarter(15), corrupting_rage
2:56.531 single_target b whirlwind Fluffy_Pillow 50.2/136: 37% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
2:57.344 single_target W bloodthirst Fluffy_Pillow 73.6/136: 54% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), corrupting_rage
2:58.157 single_target Y rampage Fluffy_Pillow 81.6/136: 60% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), corrupting_rage
2:58.972 single_target Q bloodbath Fluffy_Pillow 37.0/136: 27% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame(2), firestarter(15), corrupting_rage
2:59.787 single_target Z slam Fluffy_Pillow 64.4/136: 47% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
3:00.601 single_target W bloodthirst Fluffy_Pillow 74.4/136: 55% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
3:01.415 single_target T rampage Fluffy_Pillow 109.6/136: 81% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(15), corrupting_rage
3:02.229 default M recklessness Estî 29.6/136: 22% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(2), firestarter(15), corrupting_rage
3:02.365 single_target Q bloodbath Fluffy_Pillow 79.6/136: 59% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(2), firestarter(15), corrupting_rage
3:03.178 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(15), corrupting_rage
3:03.991 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
3:04.805 single_target R thunderous_roar Fluffy_Pillow 110.8/136: 81% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), corrupting_rage
3:05.621 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame(3), firestarter(15), corrupting_rage
3:06.436 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(3), firestarter(15), corrupting_rage
3:07.250 default L avatar Estî 110.8/136: 81% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), corrupting_rage
3:07.461 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(3), firestarter(15), corrupting_rage
3:08.276 single_target Q bloodbath Fluffy_Pillow 72.0/136: 53% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(3), roused_shadowflame(4), firestarter(15), corrupting_rage
3:09.090 single_target T rampage Fluffy_Pillow 126.8/136: 93% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), corrupting_rage
3:09.904 single_target Q bloodbath Fluffy_Pillow 85.6/136: 63% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), corrupting_rage
3:10.717 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), furious_bloodthirst, roused_shadowflame(4), firestarter(15), corrupting_rage
3:11.530 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
3:12.344 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(15), corrupting_rage
3:13.158 single_target Q bloodbath Fluffy_Pillow 92.8/136: 68% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), corrupting_rage
3:13.973 single_target P odyns_fury Fluffy_Pillow 108.8/136: 80% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame(5), firestarter(15), corrupting_rage
3:14.787 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(5), furious_bloodthirst(3), roused_shadowflame(5), firestarter(15), corrupting_rage
3:15.600 single_target Q bloodbath Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(5), firestarter(15), corrupting_rage
3:16.414 single_target T rampage Fluffy_Pillow 126.8/136: 93% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(5), firestarter(15), corrupting_rage
3:17.228 single_target Q bloodbath Fluffy_Pillow 85.6/136: 63% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst(2), roused_shadowflame(5), firestarter(15), corrupting_rage
3:18.042 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
3:18.857 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, sudden_death, furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
3:19.671 single_target U execute Fluffy_Pillow 91.2/136: 67% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(3), firestarter(15), corrupting_rage
3:20.487 single_target T rampage Fluffy_Pillow 130.6/136: 96% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), firestarter(15), corrupting_rage
3:21.301 single_target Q bloodbath Fluffy_Pillow 66.6/136: 49% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, firestarter(15), corrupting_rage
3:22.115 single_target Y rampage Fluffy_Pillow 94.0/136: 69% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15), corrupting_rage
3:22.929 single_target Q bloodbath Fluffy_Pillow 33.4/136: 25% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(15), corrupting_rage
3:23.744 single_target Z slam Fluffy_Pillow 68.6/136: 50% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
3:24.559 single_target W bloodthirst Fluffy_Pillow 78.6/136: 58% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
3:25.373 single_target T rampage Fluffy_Pillow 117.8/136: 87% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame, firestarter(15), corrupting_rage
3:26.188 single_target Q bloodbath Fluffy_Pillow 73.2/136: 54% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), corrupting_rage
3:27.005 single_target U execute Fluffy_Pillow 81.2/136: 60% rage avatar, wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(2), roused_shadowflame, firestarter(15)
3:27.820 single_target T rampage Fluffy_Pillow 120.6/136: 89% rage avatar, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(15), wafting_devotion
3:28.591 single_target Q bloodbath Fluffy_Pillow 56.6/136: 42% rage avatar, wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(2), firestarter(15), wafting_devotion
3:29.362 single_target T rampage Fluffy_Pillow 134.6/136: 99% rage avatar, wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(15), wafting_devotion
3:30.132 single_target Q bloodbath Fluffy_Pillow 70.6/136: 52% rage avatar, wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame(2), firestarter(15), wafting_devotion
3:30.904 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), roused_shadowflame(2), firestarter(15), wafting_devotion
3:31.674 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(3), firestarter(15), wafting_devotion
3:32.444 single_target T rampage Fluffy_Pillow 126.4/136: 93% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(15), wafting_devotion
3:33.215 single_target Q bloodbath Fluffy_Pillow 62.4/136: 46% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(3), firestarter(15), wafting_devotion
3:33.986 single_target T rampage Fluffy_Pillow 132.8/136: 98% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(15), wafting_devotion
3:34.757 single_target Q bloodbath Fluffy_Pillow 91.6/136: 67% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15), wafting_devotion
3:35.529 single_target T rampage Fluffy_Pillow 107.6/136: 79% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15), wafting_devotion
3:36.300 single_target Q bloodbath Fluffy_Pillow 66.4/136: 49% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15), wafting_devotion, sophic_devotion
3:37.072 single_target T rampage Fluffy_Pillow 82.4/136: 61% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15), wafting_devotion, sophic_devotion
3:37.844 single_target Q bloodbath Fluffy_Pillow 57.2/136: 42% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
3:38.615 single_target U execute Fluffy_Pillow 73.2/136: 54% rage wild_strikes, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
3:39.385 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
3:40.156 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(5), firestarter(15), wafting_devotion, sophic_devotion
3:40.927 single_target Y rampage Fluffy_Pillow 83.4/136: 61% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15), wafting_devotion, sophic_devotion
3:41.699 single_target P odyns_fury Fluffy_Pillow 3.4/136: 2% rage wild_strikes, enrage, frenzy(4), reckless_abandon, firestarter(15), wafting_devotion, sophic_devotion
3:42.473 single_target Q bloodbath Fluffy_Pillow 47.8/136: 35% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(2), furious_bloodthirst(3), firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:43.244 single_target U execute Fluffy_Pillow 75.2/136: 55% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(4), furious_bloodthirst(2), firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:44.017 single_target Y rampage Fluffy_Pillow 95.2/136: 70% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(4), furious_bloodthirst(2), roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:44.789 single_target Q bloodbath Fluffy_Pillow 46.2/136: 34% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(2), roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:45.561 single_target Z slam Fluffy_Pillow 73.6/136: 54% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:46.332 single_target Y rampage Fluffy_Pillow 83.6/136: 61% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:47.102 single_target Q bloodbath Fluffy_Pillow 39.0/136: 29% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst, roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:47.874 single_target b whirlwind Fluffy_Pillow 66.4/136: 49% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:48.646 single_target W bloodthirst Fluffy_Pillow 70.4/136: 52% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), wafting_devotion, sophic_devotion, corrupting_rage
3:49.416 single_target Y rampage Fluffy_Pillow 105.6/136: 78% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
3:50.231 single_target Q bloodbath Fluffy_Pillow 56.6/136: 42% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
3:51.078 single_target Y rampage Fluffy_Pillow 91.8/136: 67% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
3:51.893 single_target Q bloodbath Fluffy_Pillow 11.8/136: 9% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(15), corrupting_rage
3:52.710 single_target Z slam Fluffy_Pillow 47.0/136: 35% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
3:53.524 single_target W bloodthirst Fluffy_Pillow 57.0/136: 42% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame, firestarter(15), corrupting_rage
3:54.338 single_target T rampage Fluffy_Pillow 84.4/136: 62% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame, firestarter(15), corrupting_rage
3:55.152 single_target Q bloodbath Fluffy_Pillow 20.4/136: 15% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame, firestarter(15), corrupting_rage
3:55.965 single_target b whirlwind Fluffy_Pillow 47.8/136: 35% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), corrupting_rage
3:56.779 single_target W bloodthirst Fluffy_Pillow 51.8/136: 38% rage wild_strikes, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
3:57.594 single_target Z slam Fluffy_Pillow 79.2/136: 58% rage wild_strikes, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), corrupting_rage
3:58.409 single_target T rampage Fluffy_Pillow 89.2/136: 66% rage wild_strikes, frenzy(4), meat_cleaver(2), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), corrupting_rage
3:59.344 single_target Q bloodbath Fluffy_Pillow 40.2/136: 30% rage wild_strikes, enrage, frenzy(4), meat_cleaver, reckless_abandon, sudden_death, roused_shadowflame(2), firestarter(15), corrupting_rage
4:00.159 single_target U execute Fluffy_Pillow 67.6/136: 50% rage wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
4:00.973 single_target W bloodthirst Fluffy_Pillow 87.6/136: 64% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
4:01.789 trinkets d use_item_fyralath_the_dreamrender Fluffy_Pillow 115.0/136: 85% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:04.104 single_target T rampage Fluffy_Pillow 115.0/136: 85% rage wild_strikes, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:05.041 single_target Q bloodbath Fluffy_Pillow 51.0/136: 37% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:05.855 single_target U execute Fluffy_Pillow 78.4/136: 58% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:06.671 single_target U execute Fluffy_Pillow 98.4/136: 72% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:07.488 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:08.302 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(2), firestarter(15), sophic_devotion, corrupting_rage
4:09.117 single_target Y rampage Fluffy_Pillow 83.4/136: 61% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), sophic_devotion, corrupting_rage
4:09.931 single_target Q bloodbath Fluffy_Pillow 3.4/136: 2% rage wild_strikes, enrage, frenzy(4), reckless_abandon, sudden_death, roused_shadowflame(3), firestarter(15), sophic_devotion, corrupting_rage
4:10.745 single_target U execute Fluffy_Pillow 42.4/136: 31% rage wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(15), sophic_devotion, corrupting_rage
4:11.561 single_target P odyns_fury Fluffy_Pillow 62.4/136: 46% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(15), sophic_devotion, corrupting_rage
4:12.515 single_target T rampage Fluffy_Pillow 106.8/136: 79% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), furious_bloodthirst(3), roused_shadowflame(4), firestarter(15), sophic_devotion, corrupting_rage
4:13.332 single_target Q bloodbath Fluffy_Pillow 46.2/136: 34% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(3), roused_shadowflame(4), firestarter(15), sophic_devotion, corrupting_rage
4:14.145 single_target U execute Fluffy_Pillow 73.6/136: 54% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), sophic_devotion, corrupting_rage
4:14.959 single_target Y rampage Fluffy_Pillow 93.6/136: 69% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(4), firestarter(15), sophic_devotion, corrupting_rage
4:15.773 single_target Q bloodbath Fluffy_Pillow 33.0/136: 24% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, furious_bloodthirst(2), roused_shadowflame(5), firestarter(15), sophic_devotion, corrupting_rage
4:16.588 single_target Z slam Fluffy_Pillow 60.4/136: 44% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
4:17.403 single_target U execute Fluffy_Pillow 70.4/136: 52% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
4:18.218 single_target T rampage Fluffy_Pillow 117.6/136: 86% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(5), furious_bloodthirst, roused_shadowflame(5), firestarter(15), corrupting_rage
4:19.031 single_target Q bloodbath Fluffy_Pillow 64.8/136: 48% rage wild_strikes, dancing_blades, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(3), furious_bloodthirst, firestarter(15), corrupting_rage
4:19.846 single_target b whirlwind Fluffy_Pillow 72.8/136: 54% rage wild_strikes, dancing_blades, enrage, frenzy(4), slaughtering_strikes_an(3), firestarter(15), corrupting_rage
4:20.661 single_target U execute Fluffy_Pillow 96.2/136: 71% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(4), slaughtering_strikes_an(5), firestarter(15), corrupting_rage
4:21.475 single_target T rampage Fluffy_Pillow 135.6/136: 100% rage wild_strikes, dancing_blades, enrage, frenzy(4), meat_cleaver(3), slaughtering_strikes_an(5), firestarter(15), corrupting_rage
4:22.290 single_target Q bloodbath Fluffy_Pillow 55.6/136: 41% rage wild_strikes, enrage, frenzy(4), meat_cleaver(2), reckless_abandon, firestarter(15), corrupting_rage
4:23.104 single_target Y rampage Fluffy_Pillow 83.0/136: 61% rage wild_strikes, enrage, frenzy(4), meat_cleaver, slaughtering_strikes_an(2), firestarter(15), corrupting_rage
4:23.918 single_target Q bloodbath Fluffy_Pillow 3.0/136: 2% rage wild_strikes, enrage, frenzy(4), reckless_abandon, firestarter(15), corrupting_rage
4:24.732 single_target U execute Fluffy_Pillow 38.2/136: 28% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), firestarter(15), corrupting_rage
4:25.546 single_target W bloodthirst Fluffy_Pillow 58.2/136: 43% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), firestarter(15), sophic_devotion, corrupting_rage
4:26.360 single_target Y rampage Fluffy_Pillow 97.2/136: 71% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(5), firestarter(15), sophic_devotion, corrupting_rage
4:27.174 single_target Q bloodbath Fluffy_Pillow 17.2/136: 13% rage wild_strikes, enrage, frenzy(4), reckless_abandon, firestarter(15), sophic_devotion, corrupting_rage
4:27.986 single_target U execute Fluffy_Pillow 44.6/136: 33% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), firestarter(15), sophic_devotion, corrupting_rage
4:28.801 single_target W bloodthirst Fluffy_Pillow 84.0/136: 62% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), firestarter(15), sophic_devotion, corrupting_rage
4:29.615 single_target T rampage Fluffy_Pillow 92.0/136: 68% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), firestarter(15), sophic_devotion, corrupting_rage
4:30.429 single_target Q bloodbath Fluffy_Pillow 31.4/136: 23% rage wild_strikes, enrage, frenzy(4), reckless_abandon, slaughtering_strikes_an(2), firestarter(15), sophic_devotion, corrupting_rage
4:31.244 single_target U execute Fluffy_Pillow 39.4/136: 29% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:32.059 single_target W bloodthirst Fluffy_Pillow 78.8/136: 58% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:32.874 default M recklessness Estî 86.8/136: 64% rage wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(4), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:32.874 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage wild_strikes, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:33.687 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:34.501 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage enrage, frenzy(4), recklessness, roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:35.316 single_target Q bloodbath Fluffy_Pillow 69.6/136: 51% rage enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:36.130 single_target R thunderous_roar Fluffy_Pillow 85.6/136: 63% rage enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:36.943 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:37.758 default L avatar Estî 72.0/136: 53% rage enrage, frenzy(4), recklessness, reckless_abandon, roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:37.758 single_target Q bloodbath Fluffy_Pillow 122.0/136: 90% rage avatar, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(3), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:38.572 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:39.387 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(2), roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:40.201 single_target T rampage Fluffy_Pillow 126.4/136: 93% rage avatar, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(3), furious_bloodthirst, roused_shadowflame, firestarter(15), sophic_devotion, corrupting_rage
4:41.015 single_target Q bloodbath Fluffy_Pillow 46.4/136: 34% rage avatar, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst, roused_shadowflame, firestarter(15), corrupting_rage
4:41.829 single_target T rampage Fluffy_Pillow 101.2/136: 74% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame, firestarter(15), corrupting_rage
4:42.644 single_target Q bloodbath Fluffy_Pillow 76.0/136: 56% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
4:43.459 single_target P odyns_fury Fluffy_Pillow 92.0/136: 68% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), roused_shadowflame(2), firestarter(15), corrupting_rage
4:44.274 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(4), furious_bloodthirst(3), roused_shadowflame(2), firestarter(15), corrupting_rage
4:45.089 single_target Q bloodbath Fluffy_Pillow 94.8/136: 70% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, slaughtering_strikes_an(2), furious_bloodthirst(3), roused_shadowflame(2), firestarter(15), corrupting_rage
4:45.903 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, slaughtering_strikes_an(2), furious_bloodthirst(2), roused_shadowflame(3), firestarter(15), corrupting_rage
4:46.717 single_target Q bloodbath Fluffy_Pillow 85.6/136: 63% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, furious_bloodthirst(2), roused_shadowflame(3), firestarter(15), corrupting_rage
4:47.531 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), furious_bloodthirst, roused_shadowflame(3), firestarter(15), corrupting_rage
4:48.344 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, furious_bloodthirst, roused_shadowflame(3), firestarter(15), corrupting_rage
4:49.159 single_target T rampage Fluffy_Pillow 110.8/136: 81% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(3), firestarter(15), corrupting_rage
4:49.973 single_target Q bloodbath Fluffy_Pillow 108.8/136: 80% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(3), firestarter(15), corrupting_rage
4:50.786 single_target T rampage Fluffy_Pillow 124.8/136: 92% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15), corrupting_rage
4:51.600 single_target Q bloodbath Fluffy_Pillow 99.6/136: 73% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(4), firestarter(15), corrupting_rage
4:52.414 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15), corrupting_rage
4:53.227 single_target Q bloodbath Fluffy_Pillow 56.0/136: 41% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(4), firestarter(15), corrupting_rage
4:54.041 single_target T rampage Fluffy_Pillow 126.4/136: 93% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15)
4:54.854 single_target Q bloodbath Fluffy_Pillow 85.2/136: 63% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(4), firestarter(15)
4:55.669 single_target T rampage Fluffy_Pillow 136.0/136: 100% rage avatar, wild_strikes, dancing_blades, enrage, frenzy(4), recklessness, sudden_death, slaughtering_strikes_an(2), roused_shadowflame(4), firestarter(15)
4:56.483 single_target Q bloodbath Fluffy_Pillow 72.0/136: 53% rage avatar, wild_strikes, enrage, frenzy(4), recklessness, reckless_abandon, sudden_death, roused_shadowflame(4), firestarter(15)
4:57.297 single_target T rampage Fluffy_Pillow 119.0/136: 87% rage avatar, wild_strikes, enrage, frenzy(4), sudden_death, slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15)
4:58.113 single_target Q bloodbath Fluffy_Pillow 39.0/136: 29% rage avatar, wild_strikes, enrage, frenzy(4), reckless_abandon, roused_shadowflame(4), firestarter(15)
4:58.928 single_target U execute Fluffy_Pillow 74.2/136: 55% rage avatar, wild_strikes, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15)
4:59.742 single_target W bloodthirst Fluffy_Pillow 94.2/136: 69% rage avatar, enrage, frenzy(4), slaughtering_strikes_an(3), roused_shadowflame(4), firestarter(15)

Stats

Level Bonus (70) Race Bonus (gnome) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 13878 13788 9800 (7505)
Agility 1442 1 1529 1443 0
Stamina 3848 -1 46364 44156 38207
Intellect 1421 3 1585 1424 0
Spirit 0 0 0 0 0
Health 927280 883120 0
Rage 136 136 0
Spell Power 1585 1424 0
Crit 21.24% 14.66% 1739
Melee Haste 49.08% 49.08% 7410
Spell Haste 43.29% 43.29% 7410
Swing Speed 56.53% 56.53% 7410
Versatility 7.31% 4.31% 884
Attack Power 14571 13788 0
Mastery 55.81% 55.29% 5309
Armor 12460 12460 10383
Run Speed 7 0 632
Leech 5.00% 5.00% 0

Gear

Source Slot Average Item Level: 478.00
Local Head Molten Vanguard's Domeplate
ilevel: 476, stats: { 1356 Armor, +3396 Sta, +316 Crit, +668 Mastery, +831 StrInt }, enchant: incandescent_essence
Local Neck Torc of Passed Time
ilevel: 476, stats: { +1910 Sta, +841 Mastery, +841 Haste }, gems: { +75 StrAgiInt, +66 Mastery, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
Local Shoulders Molten Vanguard's Shouldervents
ilevel: 476, stats: { 1243 Armor, +2547 Sta, +519 Crit, +219 Haste, +624 StrInt }
Local Chest Molten Vanguard's Plackart
ilevel: 476, stats: { 1808 Armor, +3396 Sta, +672 Haste, +312 Mastery, +831 StrInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Primal Molten Greatbelt
ilevel: 476, stats: { 1017 Armor, +2547 Sta, +369 Mastery, +369 Haste, +624 StrInt }
Local Legs Molten Vanguard's Steel Tassets
ilevel: 476, stats: { 1582 Armor, +3396 Sta, +652 Haste, +332 Vers, +831 StrInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Lavaforged Sollerets
ilevel: 476, stats: { 1130 Armor, +2547 Sta, +510 Crit, +228 Haste, +624 StrInt, +316 RunSpeed }, enchant: { +131 Sta (watchers_loam_3) }
Local Wrists Primal Molten Vambraces
ilevel: 476, stats: { 904 Armor, +1910 Sta, +277 Mastery, +277 Haste, +468 StrInt }, enchant: { +200 Avoidance (devotion_of_avoidance_3) }
item effects: { equip: Roiling Shadowflame }
Local Hands Molten Vanguard's Crushers
ilevel: 476, stats: { 1017 Armor, +2547 Sta, +228 Haste, +511 Vers, +624 StrInt }
Local Finger1 Signet of Titanic Insight
ilevel: 476, stats: { +1910 Sta, +841 Mastery, +841 Haste }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery (devotion_of_mastery_3) }
Local Finger2 Band of Burning Thorns
ilevel: 476, stats: { +1910 Sta, +1418 Haste, +264 Mastery }, enchant: { +82 Mastery (devotion_of_mastery_3) }
Local Trinket1 Coiled Serpent Idol
ilevel: 476, stats: { +790 StrAgi, +316 RunSpeed }
item effects: { equip: Coiled Serpent Idol }
Local Trinket2 Cataclysmic Signet Brand
ilevel: 476, stats: { +790 StrAgi }
item effects: { equip: Cataclysmic Signet Brand }
Local Back Vibrant Wildercloth Shawl
ilevel: 476, stats: { 326 Armor, +1910 Sta, +277 Mastery, +277 Haste, +468 StrAgiInt }, enchant: { +125 Avoidance (graceful_avoidance_3) }
Local Main Hand Fyr'alath the Dreamrender
ilevel: 496, weapon: { 1764 - 3665, 3.6 }, stats: { +1002 Str, +4317 Sta, +394 Crit, +667 Haste }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { use: Rage of Fyr'alath, equip: Fyr'alath the Dreamrender }
Local Off Hand Obsidian Seared Claymore
ilevel: 486, weapon: { 1854 - 3092, 3.6 }, stats: { +913 Str, +3833 Sta, +511 Mastery, +511 Haste }, enchant: sophic_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Fang Adornments }

Talents

Talent Tables

RowWarrior Talents [32]
1
2
3
4
5
6
7
8
9
10
RowFury Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

warrior="Estî"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/est%C3%AE"
spec=fury
level=70
race=gnome
role=attack
position=back
talents=BgEAAAAAAAAAAAAAAAAAAAAAAEAAAAAAAAAAIBCKJARIBCJRDEiIRQIBSkkESSEhEplSSCIJBAAABEE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=thousandbone_tongueslicer
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3/off_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%cooldown.avatar.duration=0|trinket.1.cooldown.duration%%cooldown.odyns_fury.duration=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%cooldown.avatar.duration=0|trinket.2.cooldown.duration%%cooldown.odyns_fury.duration=0)
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/use_item,name=algethar_puzzle_box
actions.precombat+=/berserker_stance,toggle=on
actions.precombat+=/avatar,if=!talent.titans_torment
actions.precombat+=/recklessness,if=!talent.reckless_abandon

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge,if=time<=0.5|movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)
actions+=/potion
actions+=/pummel,if=target.debuff.casting.react
actions+=/call_action_list,name=trinkets
actions+=/ravager,if=cooldown.recklessness.remains<3|buff.recklessness.up
actions+=/lights_judgment,if=buff.recklessness.down
actions+=/berserking,if=buff.recklessness.up
actions+=/blood_fury
actions+=/fireblood
actions+=/ancestral_call
actions+=/invoke_external_buff,name=power_infusion,if=buff.avatar.remains>15&fight_remains>=135|(target.health.pct<35&talent.massacre|target.health.pct<20)&buff.avatar.up|fight_remains<=25
actions+=/avatar,if=talent.titans_torment&buff.enrage.up&raid_event.adds.in>15&!buff.avatar.up&cooldown.odyns_fury.remains|talent.berserkers_torment&buff.enrage.up&!buff.avatar.up&raid_event.adds.in>15|!talent.titans_torment&!talent.berserkers_torment&(buff.recklessness.up|target.time_to_die<20)
actions+=/recklessness,if=!raid_event.adds.exists&(talent.annihilator&cooldown.champions_spear.remains<1|cooldown.avatar.remains>40|!talent.avatar|target.time_to_die<12)
actions+=/recklessness,if=!raid_event.adds.exists&!talent.annihilator|target.time_to_die<12
actions+=/champions_spear,if=buff.enrage.up&((buff.furious_bloodthirst.up&talent.titans_torment)|!talent.titans_torment|target.time_to_die<20|active_enemies>1|!set_bonus.tier31_2pc)&raid_event.adds.in>15
actions+=/run_action_list,name=multi_target,if=active_enemies>=2
actions+=/run_action_list,name=single_target,if=active_enemies=1

actions.multi_target=recklessness,if=raid_event.adds.in>15|active_enemies>1|target.time_to_die<12
actions.multi_target+=/odyns_fury,if=active_enemies>1&talent.titanic_rage&(!buff.meat_cleaver.up|buff.avatar.up|buff.recklessness.up)
actions.multi_target+=/whirlwind,if=spell_targets.whirlwind>1&talent.improved_whirlwind&!buff.meat_cleaver.up|raid_event.adds.in<2&talent.improved_whirlwind&!buff.meat_cleaver.up
actions.multi_target+=/execute,if=buff.ashen_juggernaut.up&buff.ashen_juggernaut.remains<gcd
actions.multi_target+=/rampage,if=talent.anger_management&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
actions.multi_target+=/thunderous_roar,if=buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)
actions.multi_target+=/odyns_fury,if=active_enemies>1&buff.enrage.up&raid_event.adds.in>15
actions.multi_target+=/whirlwind,if=buff.meat_cleaver.stack=1&buff.hurricane.up&rage<80&rage>60
actions.multi_target+=/bloodbath,if=set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95|set_bonus.tier31_4pc
actions.multi_target+=/bloodthirst,if=(set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95)|(!talent.reckless_abandon&buff.furious_bloodthirst.up&buff.enrage.up)
actions.multi_target+=/crushing_blow,if=talent.wrath_and_fury&buff.enrage.up
actions.multi_target+=/odyns_fury,if=buff.enrage.up&raid_event.adds.in>15
actions.multi_target+=/rampage,if=buff.recklessness.up|buff.enrage.remains<gcd|(rage>110&talent.overwhelming_rage)|(rage>80&!talent.overwhelming_rage)
actions.multi_target+=/bloodbath,if=buff.enrage.up&talent.reckless_abandon&!talent.wrath_and_fury
actions.multi_target+=/execute,if=buff.enrage.up&talent.ashen_juggernaut
actions.multi_target+=/bloodthirst,if=buff.enrage.down|(talent.annihilator&!buff.recklessness.up)
actions.multi_target+=/onslaught,if=!talent.annihilator&buff.enrage.up|talent.tenderize
actions.multi_target+=/execute,if=buff.enrage.up
actions.multi_target+=/raging_blow,if=charges>1&talent.wrath_and_fury
actions.multi_target+=/crushing_blow,if=charges>1&talent.wrath_and_fury
actions.multi_target+=/bloodbath,if=buff.enrage.down|!talent.wrath_and_fury
actions.multi_target+=/crushing_blow,if=buff.enrage.up&talent.reckless_abandon
actions.multi_target+=/bloodthirst,if=!talent.wrath_and_fury
actions.multi_target+=/raging_blow,if=charges>=1
actions.multi_target+=/rampage
actions.multi_target+=/slam,if=talent.annihilator
actions.multi_target+=/bloodbath
actions.multi_target+=/raging_blow
actions.multi_target+=/crushing_blow
actions.multi_target+=/bloodthirst
actions.multi_target+=/whirlwind

actions.single_target=whirlwind,if=spell_targets.whirlwind>1&talent.improved_whirlwind&!buff.meat_cleaver.up|raid_event.adds.in<2&talent.improved_whirlwind&!buff.meat_cleaver.up
actions.single_target+=/execute,if=buff.ashen_juggernaut.up&buff.ashen_juggernaut.remains<gcd
actions.single_target+=/odyns_fury,if=(buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)&(talent.dancing_blades&buff.dancing_blades.remains<5|!talent.dancing_blades))
actions.single_target+=/rampage,if=talent.anger_management&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
actions.single_target+=/bloodbath,if=set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95
actions.single_target+=/bloodthirst,if=(set_bonus.tier30_4pc&action.bloodthirst.crit_pct_current>=95)|(!talent.reckless_abandon&buff.furious_bloodthirst.up&buff.enrage.up&(!dot.gushing_wound.remains|buff.champions_might.up))
actions.single_target+=/bloodbath,if=set_bonus.tier31_2pc
actions.single_target+=/thunderous_roar,if=buff.enrage.up&(spell_targets.whirlwind>1|raid_event.adds.in>15)
actions.single_target+=/onslaught,if=buff.enrage.up|talent.tenderize
actions.single_target+=/crushing_blow,if=talent.wrath_and_fury&buff.enrage.up&!buff.furious_bloodthirst.up
actions.single_target+=/execute,if=buff.enrage.up&!buff.furious_bloodthirst.up&buff.ashen_juggernaut.up|buff.sudden_death.remains<=gcd&(target.health.pct>35&talent.massacre|target.health.pct>20)
actions.single_target+=/rampage,if=talent.reckless_abandon&(buff.recklessness.up|buff.enrage.remains<gcd|rage.pct>85)
actions.single_target+=/execute,if=buff.enrage.up
actions.single_target+=/rampage,if=talent.anger_management
actions.single_target+=/execute
actions.single_target+=/bloodbath,if=buff.enrage.up&talent.reckless_abandon&!talent.wrath_and_fury
actions.single_target+=/rampage,if=target.health.pct<35&talent.massacre.enabled
actions.single_target+=/bloodthirst,if=(buff.enrage.down|(talent.annihilator&!buff.recklessness.up))&!buff.furious_bloodthirst.up
actions.single_target+=/raging_blow,if=charges>1&talent.wrath_and_fury
actions.single_target+=/crushing_blow,if=charges>1&talent.wrath_and_fury&!buff.furious_bloodthirst.up
actions.single_target+=/bloodbath,if=buff.enrage.down|!talent.wrath_and_fury
actions.single_target+=/crushing_blow,if=buff.enrage.up&talent.reckless_abandon&!buff.furious_bloodthirst.up
actions.single_target+=/bloodthirst,if=!talent.wrath_and_fury&!buff.furious_bloodthirst.up
actions.single_target+=/raging_blow,if=charges>1
actions.single_target+=/rampage
actions.single_target+=/slam,if=talent.annihilator
actions.single_target+=/bloodbath
actions.single_target+=/raging_blow
actions.single_target+=/crushing_blow,if=!buff.furious_bloodthirst.up
actions.single_target+=/bloodthirst
actions.single_target+=/whirlwind
actions.single_target+=/wrecking_throw
actions.single_target+=/storm_bolt

actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.avatar.up
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.recklessness.remains<3|(talent.anger_management&cooldown.avatar.remains<3)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.avatar.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.avatar.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.avatar.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.avatar.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.avatar.up|!trinket.1.cast_time>0)|cooldown.avatar.remains_expected>20)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.avatar.up|!trinket.2.cast_time>0)|cooldown.avatar.remains_expected>20)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)

head=molten_vanguards_domeplate,id=207182,bonus_id=6652/9599/7980/9571/9513/1507/8767,enchant=incandescent_essence
neck=torc_of_passed_time,id=201759,bonus_id=8836/8840/8902/9477/8782/9405/8793/9499/9498,gems=75stragiint_66mastery_70haste_33mastery_70haste_33mastery,crafted_stats=vers/crit
shoulders=molten_vanguards_shouldervents,id=207180,bonus_id=6652/7980/9511/9571/1507/8767
back=vibrant_wildercloth_shawl,id=193511,bonus_id=8836/8840/8902/9405/9499/8793/9498,enchant=graceful_avoidance_3,crafted_stats=vers/crit
chest=molten_vanguards_plackart,id=207185,bonus_id=6652/9571/7980/8094/9515/1507,enchant=waking_stats_3
wrists=primal_molten_vambraces,id=190502,bonus_id=8836/8840/8902/9405/9499/8793/9379/8960/9498/9599,enchant=devotion_of_avoidance_3,crafted_stats=crit/haste
hands=molten_vanguards_crushers,id=207183,bonus_id=6652/7980/9514/9571/1507/8767
waist=primal_molten_greatbelt,id=190501,bonus_id=8836/8840/8902/9405/9499/8793/9498/9599,crafted_stats=haste/crit
legs=molten_vanguards_steel_tassets,id=207181,bonus_id=6652/7980/9512/9571/1507/8767,enchant=lambent_armor_kit_3
feet=lavaforged_sollerets,id=207148,bonus_id=42/9508/7980/9571/1507/8767,enchant=watchers_loam_3
finger1=signet_of_titanic_insight,id=192999,bonus_id=8836/8840/8902/8780/9405/8793/9499/9498,gems=70haste_33mastery,enchant=devotion_of_mastery_3,crafted_stats=vers/mastery
finger2=band_of_burning_thorns,id=207159,bonus_id=6652/9600/7980/9571/1507/8767,enchant=devotion_of_mastery_3
trinket1=coiled_serpent_idol,id=207175,bonus_id=42/7980/9571/1507/8767
trinket2=cataclysmic_signet_brand,id=207166,bonus_id=6652/7979/9567/1507/8767
main_hand=fyralath_the_dreamrender,id=206448,bonus_id=10351/9495/1468,enchant=wafting_devotion_3
off_hand=obsidian_seared_claymore,id=190514,bonus_id=8836/8840/8902/9405/9500/8793/8796/8960/9498,enchant=sophic_devotion_3,crafted_stats=crit/mastery

# Gear Summary
# gear_ilvl=477.88
# gear_strength=9800
# gear_stamina=38207
# gear_crit_rating=1739
# gear_haste_rating=7410
# gear_mastery_rating=5309
# gear_versatility_rating=884
# gear_speed_rating=632
# gear_avoidance_rating=325
# gear_armor=10383
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 126579861
Max Event Queue: 69
Sim Seconds: 3002019
CPU Seconds: 80.1344
Physical Seconds: 39.5401
Speed Up: 37462

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Estî Estî annihilator 383915 2968795 9896 106.07 4256 8652 530.3 530.3 30.5% 0.0% 0.0% 0.0% 0.89sec 4241243 299.99sec
Estî Estî augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî auto_attack_mh 0 4041461 13472 53.99 12493 24985 269.9 269.9 20.0% 0.1% 0.0% 0.0% 1.33sec 5773663 299.99sec
Estî Estî auto_attack_oh 1 1913424 6378 52.21 6114 12225 261.1 261.1 20.0% 0.1% 0.0% 0.0% 1.33sec 2733532 299.99sec
Estî Estî avatar 107574 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.45sec 0 299.99sec
Estî Estî avatar_torment 107574 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 27.79sec 0 299.99sec
Estî Estî berserker_stance 386196 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî bloodbath 335096 17936087 59789 26.94 50131 204901 134.7 134.7 53.6% 0.0% 0.0% 0.0% 2.21sec 25623634 299.99sec
Estî Estî bloodthirst 23881 1108805 3696 5.93 27938 68956 29.6 29.6 23.1% 0.0% 0.0% 0.0% 8.82sec 1584047 299.99sec
Estî Estî bloodthirst_heal 117313 0 0 0.00 0 0 164.3 0.0 0.0% 0.0% 0.0% 0.0% 1.81sec 0 299.99sec
Estî Estî charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî charge_impact 100 4089 14 0.20 3360 6720 1.0 1.0 21.7% 0.0% 0.0% 0.0% 0.00sec 5841 299.99sec
Estî Estî execute 5308 0 0 0.00 0 0 21.5 0.0 0.0% 0.0% 0.0% 0.0% 13.08sec 0 299.99sec
Estî Estî execute_mainhand 280849 975598 3252 4.31 36774 73672 0.0 21.5 23.1% 0.0% 0.0% 0.0% 0.00sec 1393747 299.99sec
Estî Estî execute_offhand 163558 536853 1790 4.31 20253 40625 0.0 21.5 23.0% 0.0% 0.0% 0.0% 0.00sec 766952 299.99sec
Estî Estî fang_adornments_oh 377708 845334 2818 13.07 12932 0 65.4 65.4 0.0% 0.0% 0.0% 0.0% 4.55sec 1207650 299.99sec
Estî Estî flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî food 382156 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî gushing_wound ticks -385042 2556103 8520 25.85 15009 30620 79.1 129.2 30.6% 0.0% 0.0% 0.0% 3.75sec 2556103 299.99sec
Estî Estî igiras_cruel_nightmare 426339 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 25.97sec 0 299.99sec
Estî Estî flaying_torment ticks -426527 1452961 4843 5.95 48814 0 10.7 29.8 0.0% 0.0% 0.0% 0.0% 25.97sec 1452961 299.99sec
Estî Estî lava_bolt 427037 1608286 5361 18.47 14522 29046 92.3 92.3 20.0% 0.0% 0.0% 0.0% 4.83sec 1608286 299.99sec
Estî Estî lava_bolt_dot 427059 0 0 0.00 0 0 11.7 0.0 0.0% 0.0% 0.0% 0.0% 25.05sec 0 299.99sec
Estî Estî mark_of_fyralath ticks -414532 808546 2695 29.41 4581 9163 2066.4 147.0 20.0% 0.0% 0.0% 0.0% 0.24sec 808546 299.99sec
Estî Estî odyns_fury 385059 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 27.79sec 0 299.99sec
Estî Estî odyns_fury_mh 385060 906153 3021 4.47 30708 62392 22.4 22.4 31.0% 0.0% 0.0% 0.0% 27.79sec 2468038 299.99sec
Estî Estî odyns_fury_mh ticks -385060 1173501 3912 8.87 20151 40427 22.4 44.3 31.1% 0.0% 0.0% 0.0% 27.79sec 2468038 299.99sec
Estî Estî odyns_fury_oh 385061 381752 1273 4.47 12937 26299 22.4 22.4 31.0% 0.0% 0.0% 0.0% 27.79sec 545374 299.99sec
Estî Estî odyns_fury_torment 385059 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.45sec 0 299.99sec
Estî Estî odyns_fury_torment_mh 385060 363215 1211 1.47 35244 70519 7.4 7.4 40.1% 0.0% 0.0% 0.0% 90.45sec 933933 299.99sec
Estî Estî odyns_fury_torment_mh ticks -385060 415041 1383 2.93 20279 40583 7.4 14.6 39.9% 0.0% 0.0% 0.0% 90.45sec 933933 299.99sec
Estî Estî odyns_fury_torment_oh 385061 152839 509 1.47 14850 29718 7.4 7.4 39.9% 0.0% 0.0% 0.0% 90.45sec 218347 299.99sec
Estî Estî overwhelming_rage ticks -374037 882535 2942 3.95 44669 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.95sec 916026 299.99sec
Estî Estî potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Estî Estî rage_of_fyralath_channel 417132 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.27sec 0 299.99sec
Estî Estî rage_of_fyralath 417134 1403361 4678 3.57 65284 130654 17.8 17.8 20.5% 0.0% 0.0% 0.0% 15.24sec 1403361 299.99sec
Estî Estî explosive_rage 413584 930504 3102 0.59 261047 522465 3.0 3.0 20.3% 0.0% 0.0% 0.0% 121.36sec 930504 299.99sec
Estî Estî rampage 184367 0 0 0.00 0 0 135.1 0.0 0.0% 0.0% 0.0% 0.0% 2.21sec 0 299.99sec
Estî Estî rampage1 184707 1884645 6282 27.01 10432 20979 0.0 135.1 33.4% 0.0% 0.0% 0.0% 0.00sec 2692418 299.99sec
Estî Estî rampage2 184709 2248025 7494 27.00 12467 25076 0.0 135.0 33.2% 0.0% 0.0% 0.0% 0.00sec 3211546 299.99sec
Estî Estî rampage3 201364 2521569 8405 26.97 14005 28191 0.0 134.9 33.1% 0.0% 0.0% 0.0% 0.00sec 3602333 299.99sec
Estî Estî rampage4 201363 2901504 9672 26.97 16119 32452 0.0 134.8 33.1% 0.0% 0.0% 0.0% 0.00sec 4145111 299.99sec
Estî Estî recklessness 1719 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.17sec 0 299.99sec
Estî Estî roiling_shadowflame 406251 772468 2575 10.64 12108 24176 53.2 53.2 20.0% 0.0% 0.0% 0.0% 5.57sec 772468 299.99sec
Estî Estî sidearm 384391 1020129 3401 21.21 7316 14871 106.1 106.0 30.5% 0.0% 0.0% 0.0% 3.05sec 1457364 299.99sec
Estî Estî slam 1464 1094119 3647 4.12 37414 78432 20.6 20.6 38.4% 0.0% 0.0% 0.0% 11.56sec 1563068 299.99sec
Estî Estî storm_bolt 107570 5722 19 0.12 7632 15285 0.6 0.6 21.3% 0.0% 0.0% 0.0% 90.93sec 8175 299.99sec
Estî Estî thunderous_roar 384318 260846 870 0.74 50224 100664 3.7 3.7 40.2% 0.0% 0.0% 0.0% 90.60sec 372647 299.99sec
Estî Estî thunderous_roar_dot ticks -397364 1401028 4670 7.74 25856 51971 3.7 38.7 39.6% 0.0% 0.0% 0.0% 90.60sec 1401028 299.99sec
Estî Estî vicious_brand ticks -425154 2886701 9622 30.56 15753 31507 32.6 152.8 19.9% 0.0% 0.0% 0.0% 9.02sec 2886701 299.99sec
Estî Estî radiating_brand 425156 0 0 0.00 0 0 82.9 0.0 0.0% 0.0% 0.0% 0.0% 1.89sec 0 299.99sec
Estî Estî vicious_brand_self ticks -425180 1078784 3596 26.05 8282 0 27.6 130.3 0.0% 0.0% 0.0% 0.0% 9.24sec 1119722 299.99sec
Estî Estî whirlwind 190411 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 18.65sec 0 299.99sec
Estî Estî whirlwind_mh_first 199667 81218 271 2.14 6106 12814 10.7 10.7 22.0% 0.0% 0.0% 0.0% 18.65sec 116029 299.99sec
Estî Estî whirlwind_mh_others 199852 161821 539 4.28 6100 12798 21.4 21.4 21.7% 0.0% 0.0% 0.0% 8.88sec 231179 299.99sec
Estî Estî whirlwind_oh_first 44949 42493 142 2.14 3204 6719 10.7 10.7 21.7% 0.0% 0.0% 0.0% 18.65sec 60705 299.99sec
Estî Estî whirlwind_oh_others 199851 84947 283 4.28 3200 6713 21.4 21.4 21.8% 0.0% 0.0% 0.0% 8.88sec 121355 299.99sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
198501.1 0.0 Health 0.00% 0.0 100.0% 100%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Coiled Serpent Idol 3.6 0.0 75.2s 75.2s 9.8s 11.67% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:Estî
  • cooldown name:buff_coiled_serpent_idol
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.4s / 182.3s
  • trigger_min/max:30.4s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.89% / 21.10%

Stack Uptimes

  • coiled_serpent_idol_3:11.67%

Spelldata

  • id:427056
  • name:Coiled Serpent Idol
  • tooltip:
  • description:{$@spelldesc426827=Your critical strikes have a chance to summon a lava serpent to attack your target for 10 sec. The serpent spews a lava bolt every 2 sec, dealing {$s1=1553} Volcanic damage. Every third summoning, call forth three serpents instead. If the target dies, the serpent enrages to deal {$s2=2877} Volcanic damage to up to 8 nearby enemies. }
  • max_stacks:3
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 199588.22
Minimum 183618.43
Maximum 223000.78
Spread ( max - min ) 39382.35
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 4687.4955
5th Percentile 192190.07
95th Percentile 207366.43
( 95th Percentile - 5th Percentile ) 15176.37
Mean Distribution
Standard Deviation 46.8773
95.00% Confidence Interval ( 199496.34 - 199680.09 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2119
0.1 Scale Factor Error with Delta=300 187571
0.05 Scale Factor Error with Delta=300 750284
0.01 Scale Factor Error with Delta=300 18757087
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1356
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 47977560 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.