SimulationCraft 1025-01      berechnet von Metaux@Antonidas

for World of Warcraft 10.2.5.53262 Live (hotfix 2024-02-15/53262, git build 808ba22546)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Rakshasâ : 217214 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
217213.9 217213.9 128.5 / 0.059% 25628.2 / 11.8% 77.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
2727.0 2717.8 Mana 0.00% 50.9 100.0% 100%
Origin https://worldofwarcraft.com/en-gb/character/antonidas/rakshas%C3%A2
TalentBAEAAAAAAAAAAAAAAAAAAAAAAQEUSDJSkigcgkIRERSAAAIlEJhEJJhkkkkkEAAAAAAAAAICA
Set Bonus
Scale Factors for Rakshasâ Damage Per Second
Int SP Haste Vers Mastery Crit
Scale Factors 14.30 13.01 9.80 8.91 8.58 5.93
Normalized 1.00 0.91 0.69 0.62 0.60 0.41
Scale Deltas 595 595 595 595 595 595
Error 0.31 0.31 0.31 0.31 0.31 0.31
Ranking
  • Int > SP > Haste > Vers > Mastery > Crit
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, Intellect=14.30, SpellPower=13.01, CritRating=5.93, HasteRating=9.80, MasteryRating=8.58, Versatility=8.91 )

Scale Factors for other metrics

Scale Factors for Rakshasâ Priority Target Damage Per Second
Int SP Haste Vers Mastery Crit
Scale Factors 14.30 13.01 9.80 8.91 8.58 5.93
Normalized 1.00 0.91 0.69 0.62 0.60 0.41
Scale Deltas 595 595 595 595 595 595
Error 0.31 0.31 0.31 0.31 0.31 0.31
Ranking
  • Int > SP > Haste > Vers > Mastery > Crit
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, Intellect=14.30, SpellPower=13.01, CritRating=5.93, HasteRating=9.80, MasteryRating=8.58, Versatility=8.91 )
Scale Factors for Rakshasâ Damage Per Second (Effective)
Int SP Haste Vers Mastery Crit
Scale Factors 14.30 13.01 9.80 8.91 8.58 5.93
Normalized 1.00 0.91 0.69 0.62 0.60 0.41
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > SP > Haste > Vers > Mastery > Crit
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, Intellect=14.30, SpellPower=13.01, CritRating=5.93, HasteRating=9.80, MasteryRating=8.58, Versatility=8.91 )
Scale Factors for Rakshasâ Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for RakshasâTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Rakshasâ Fight Length
Int Mastery Crit Vers SP Haste
Scale Factors -0.00 -0.00 -0.00 -0.00 -0.00 -0.00
Normalized 1.00 1.00 1.00 0.99 0.00 0.00
Scale Deltas 595 595 595 595 595 595
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > Mastery > Crit > Vers > SP > Haste
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, Intellect=0.00, SpellPower=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00 )
Scale Factors for Raid Damage Per Second
Int SP Haste Vers Mastery Crit
Scale Factors 14.30 13.01 9.80 8.91 8.58 5.93
Normalized 1.00 0.91 0.69 0.62 0.60 0.41
Scale Deltas 595 595 595 595 595 595
Error 0.31 0.31 0.31 0.31 0.31 0.31
Ranking
  • Int > SP > Haste > Vers > Mastery > Crit
Pawn string ( Pawn: v1: "Rakshasâ-Frost": Class=Mage, Spec=Frost, Intellect=14.30, SpellPower=13.01, CritRating=5.93, HasteRating=9.80, MasteryRating=8.58, Versatility=8.91 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rakshasâ 217214
Annihilating Flame 10183 4.7% 58.3 4.67s 52431 0 Direct 58.3 39665 79319 52434 32.2%

Stats Details: Annihilating Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.31 58.31 0.00 0.00 0.00 0.0000 0.0000 3057036.67 3057036.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.80% 39.53 3 101 39665.46 1 532112 40748.05 13566 113008 1567867 1567867 0.00%
crit 32.20% 18.77 1 48 79318.89 5 1072380 81532.54 67 340958 1489170 1489170 0.00%

Action Details: Annihilating Flame

  • id:426564
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137182.66
  • base_dd_max:137182.66
  • base_dd_mult:1.00

Spelldata

  • id:426564
  • name:Annihilating Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc423124=Your spells and abilities have a low chance to grant Annihilating Flame for {$426553d=20 seconds}, causing your critical strikes to deal {$s2=50}% additional damage as Fire split between nearby enemies. The Flame may deal {$=}{{$s1=34958}*(1+{$@=}versadmg)} total damage before fading, further increased by critical strikes. Damage and cap increased per enemy struck, up to 5.}
Comet Storm 0 (9255) 0.0% (4.3%) 10.8 28.85s 256310 267784

Stats Details: Comet Storm

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.83 0.00 0.00 0.00 0.00 0.9572 0.0000 0.00 0.00 0.00% 267784.26 267784.26

Action Details: Comet Storm

  • id:153595
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:153595
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.

Action Priority List

    st
    [H]:10.83
  • if_expr:prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
    Comet Storm (_projectile) 9255 4.3% 75.4 3.81s 36823 0 Direct 75.4 18633 37615 36823 95.8%

Stats Details: Comet Storm Projectile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 75.35 75.35 0.00 0.00 0.00 0.0000 0.0000 2774780.52 2774780.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 4.17% 3.14 0 11 18633.37 14024 25406 17550.75 0 25175 58528 58528 0.00%
crit 95.83% 72.21 49 97 37614.73 28993 53353 37633.87 35235 40947 2716253 2716253 0.00%

Action Details: Comet Storm Projectile

  • id:153596
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.459246
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153596
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:{$@spelldesc153595=Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.}
Flurry 0 (15352) 0.0% (7.1%) 44.0 6.86s 104649 110339

Stats Details: Flurry

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.97 0.00 0.00 0.00 0.00 0.9484 0.0000 0.00 0.00 0.00% 110339.08 110339.08

Action Details: Flurry

  • id:44614
  • school:frost
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.

Action Priority List

    cds
    [E]:1.00
  • if_expr:time=0&active_enemies<=2
    st
    [I]:42.97
  • if_expr:cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&((prev_gcd.1.frostbolt&buff.icicles.react>=3|prev_gcd.1.frostbolt&buff.brain_freeze.react)|prev_gcd.1.glacial_spike|talent.glacial_spike&buff.icicles.react=4&!buff.fingers_of_frost.react)
    Flurry (_bolt) 12946 6.0% 131.6 2.26s 29495 0 Direct 131.6 15807 33557 29495 77.1%

Stats Details: Flurry Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.56 131.56 0.00 0.00 0.00 0.0000 0.0000 3880239.70 3880239.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 22.88% 30.11 13 49 15806.64 9009 25242 15798.11 13906 17500 475877 475877 0.00%
crit 77.12% 101.45 68 144 33556.92 18920 53007 33547.25 30848 36452 3404363 3404363 0.00%

Action Details: Flurry Bolt

  • id:228354
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.380710
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$=}w1%.
  • description:{$@spelldesc44614=Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.}
    (flurry_) Icicle 409 0.2% 3.8 61.08s 32633 0 Direct 3.7 22992 53244 32748 32.2%

Stats Details: Flurry Icicle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.76 3.75 0.00 0.00 0.00 0.0000 0.0000 122682.37 122682.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.75% 2.54 0 10 22992.31 17146 39340 21415.30 0 37194 58360 58360 0.00%
crit 32.25% 1.21 0 7 53244.44 41163 91269 37999.18 0 85707 64322 64322 0.00%

Action Details: Flurry Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched.{$?a321684=true}[ Increases the damage of Frozen Orb, Blizzard, and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.][]}
    Glacial Assault 1997 0.9% 32.9 8.94s 18207 0 Direct 32.9 8827 18479 18207 97.2%

Stats Details: Glacial Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.88 32.88 0.00 0.00 0.00 0.0000 0.0000 598548.37 598548.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 2.82% 0.93 0 6 8827.20 6961 12693 5233.88 0 12693 8194 8194 0.00%
crit 97.18% 31.95 11 58 18479.15 14618 26900 18474.38 16938 20193 590355 590355 0.00%

Action Details: Glacial Assault

  • id:379029
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.333270
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:379029
  • name:Glacial Assault
  • school:frost
  • tooltip:
  • description:{$@spelldesc378947=Your Comet Storm now increases the damage enemies take from you by {$417490s1=6}% for {$417490d=6 seconds} and Flurry has a {$s1=25}% chance each hit to call down an icy comet, crashing into your target and nearby enemies for {$379029s1=0} Frost damage.}
Frostbolt 8955 (9236) 4.1% (4.3%) 46.6 6.06s 59495 50711 Direct 47.4 (50.0) 28588 67669 56633 71.8% (69.8%)

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.55 47.41 0.00 0.00 0.00 1.1732 0.0000 2685065.37 2685065.37 0.00% 50711.47 50711.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 28.24% 13.39 0 32 28587.75 20997 44414 28628.00 0 35331 382697 382697 0.00%
crit 71.76% 34.02 18 53 67669.42 48713 103985 67707.32 62168 75847 2302369 2302369 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.806610
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.{$?a378749=false}[ Frostbolt deals {$378749m1=40}% additional damage to Frozen targets.][]

Action Priority List

    st
    [Q]:46.75
    (frostbolt_) Icicle 281 0.1% 2.6 66.91s 31938 0 Direct 2.6 22246 51509 32078 33.6%

Stats Details: Frostbolt Icicle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.65 2.63 0.00 0.00 0.00 0.0000 0.0000 84491.05 84491.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.40% 1.75 0 10 22245.74 17316 39340 17899.13 0 37113 38904 38904 0.00%
crit 33.60% 0.88 0 7 51509.01 39778 87950 29815.75 0 84149 45587 45587 0.00%

Action Details: Frostbolt Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched.{$?a321684=true}[ Increases the damage of Frozen Orb, Blizzard, and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.][]}
Frozen Orb 0 (4371) 0.0% (2.0%) 6.0 52.97s 219898 230466

Stats Details: Frozen Orb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 0.00 0.9542 0.0000 0.00 0.00 0.00% 230465.79 230465.79

Action Details: Frozen Orb

  • id:84714
  • school:frost
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=true}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.

Action Priority List

    st
    [M]:5.96
  • if_expr:buff.fingers_of_frost.react<2&(!talent.ray_of_frost|cooldown.ray_of_frost.remains)
    Frozen Orb (_bolt) 4371 2.0% 140.1 1.95s 9351 0 Direct 140.1 5435 11739 9351 62.1%

Stats Details: Frozen Orb Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 140.12 140.12 0.00 0.00 0.00 0.0000 0.0000 1310198.00 1310198.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 37.88% 53.08 24 86 5434.73 4286 8006 5437.33 4951 6045 288465 288465 0.00%
crit 62.12% 87.04 52 131 11738.53 9406 16812 11742.48 10986 12662 1021733 1021733 0.00%

Action Details: Frozen Orb Bolt

  • id:84721
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:9.5
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.111320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=0}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=true}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.}
Glacial Spike 93217 42.9% 39.2 7.55s 713584 414205 Direct 39.1 (39.1) 320561 764009 715346 89.0% (89.0%)

Stats Details: Glacial Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.17 39.08 0.00 0.00 0.00 1.7228 0.0000 27953434.13 27953434.13 0.00% 414204.72 414204.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 10.97% 4.29 0 13 320561.09 251589 502171 316101.91 0 486223 1374098 1374098 0.00%
crit 89.03% 34.79 23 48 764008.80 583685 1165038 764094.19 724399 809257 26579336 26579336 0.00%

Action Details: Glacial Spike

  • id:199786
  • school:frost
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500650
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:199786
  • name:Glacial Spike
  • school:frost
  • tooltip:Frozen in place.
  • description:Conjures a massive spike of ice, and merges your current Icicles into it. It impales your target, dealing {$228600s1=0} damage plus all of the damage stored in your Icicles, and freezes the target in place for {$228600d=4 seconds}. Damage may interrupt the freeze effect. Requires 5 Icicles to cast. |cFFFFFFFFPassive:|r Ice Lance no longer launches Icicles.

Action Priority List

    st
    [L]:32.84
  • if_expr:buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
    st
    [O]:6.56
  • if_expr:buff.icicles.react=5
    Glacial Blast 0 0.0% 33.9 8.66s

Stats Details: Glacial Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Glacial Blast

  • id:424120
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:133864.32
  • base_dd_max:133864.32
  • base_dd_mult:1.00

Spelldata

  • id:424120
  • name:Glacial Blast
  • school:frost
  • tooltip:
  • description:{$@spelldesc422884=Glacial Spike damage increased by {$s1=16}% and it explodes when it Shatters a frozen target, dealing {$s2=15}% of its damage dealt to nearby enemies. Deals reduced damage beyond {$s3=8} targets.}
Ice Lance 35956 (36409) 16.5% (16.8%) 90.6 3.30s 120432 127046 Direct 90.4 (94.6) 56875 121015 119170 97.1% (94.3%)

Stats Details: Ice Lance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.62 90.44 0.00 0.00 0.00 0.9479 0.0000 10777909.57 10777909.57 0.00% 127046.34 127046.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 2.88% 2.60 0 12 56874.51 14603 91718 52176.09 0 89232 147946 147946 0.00%
crit 97.12% 87.84 61 120 121014.63 30420 192608 121055.71 114175 129168 10629964 10629964 0.00%

Action Details: Ice Lance

  • id:30455
  • school:frost
  • range:40.0
  • travel_speed:47.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.424592
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=true}[, and {$=}{{$228598s1=0}*{$56377m2=80}/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.

Action Priority List

    st
    [J]:6.29
  • if_expr:talent.glacial_spike&debuff.winters_chill.down&buff.icicles.react=4&buff.fingers_of_frost.react
    st
    [P]:84.33
  • if_expr:buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
    (ice_lance_) Icicle 453 0.2% 4.2 51.77s 32489 0 Direct 4.2 22484 52200 32626 34.1%

Stats Details: Ice Lance Icicle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.19 4.17 0.00 0.00 0.00 0.0000 0.0000 136006.34 136006.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.87% 2.75 0 14 22484.46 17060 39340 20847.99 0 37062 61740 61740 0.00%
crit 34.13% 1.42 0 8 52200.34 39580 86290 39060.02 0 85707 74266 74266 0.00%

Action Details: Ice Lance Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched.{$?a321684=true}[ Increases the damage of Frozen Orb, Blizzard, and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.][]}
Ray of Frost 25154 11.6% 6.1 52.88s 1242869 368714 Periodic 30.2 121522 258223 249931 93.9% 6.3%

Stats Details: Ray Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 30.20 30.20 0.00 3.3709 0.6275 7547954.38 7547954.38 0.00% 368714.49 368714.49
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 6.07% 1.83 0 10 121521.94 64326 201094 93202.94 0 201094 222651 222651 0.00%
crit 93.93% 28.37 16 35 258222.92 145842 422298 258169.70 233576 281911 7325304 7325304 0.00%

Action Details: Ray Of Frost

  • id:205021
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.954000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:205021
  • name:Ray of Frost
  • school:frost
  • tooltip:Movement slowed by {$=}w1%. Taking {$=}w2 Frost damage every {$t2=1} sec.
  • description:Channel an icy beam at the enemy for {$d=5 seconds}, dealing {$s2=0} Frost damage every {$t2=1} sec and slowing movement by {$s4=60}%. Each time Ray of Frost deals damage, its damage and snare increases by {$208141s1=10}%. Generates {$s3=2} charges of Fingers of Frost over its duration.

Action Priority List

    st
    [K]:6.07
  • if_expr:remaining_winters_chill=1
Roiling Shadowflame 2532 1.2% 42.6 6.95s 17842 0 Direct 42.6 13509 27003 17842 32.1%

Stats Details: Roiling Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 0.00 0.0000 0.0000 759885.60 759885.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.89% 28.91 13 48 13508.85 8897 21214 13504.75 12063 14967 390598 390598 0.00%
crit 32.11% 13.68 3 30 27003.46 17793 42427 26995.92 20936 33552 369287 369287 0.00%

Action Details: Roiling Shadowflame

  • id:406251
  • school:shadowflame
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7137.39
  • base_dd_max:7137.39
  • base_dd_mult:1.00

Spelldata

  • id:406251
  • name:Roiling Shadowflame
  • school:shadowflame
  • tooltip:Suffering {$=}w1 Shadowflame damage.
  • description:{$@spelldesc406254=Dealing damage has a chance to rouse the Shadowflame, inflicting {$s2=867} Shadowflame damage upon your target and {$s3=116} Shadowflame damage to yourself. Whenever this happens, you gain a stack of Roused Shadowflame. Roused Shadowflame increases this effects damage by {$s4=20}%, stacking {$406887u=5} times. Upon reaching maximum stacks, the Roused Shadowflame will subside.}
Shifting Power 1915 0.9% 4.8 65.83s 118776 42545 Periodic 19.2 14990 33614 29858 79.8% 4.1%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.83 0.00 19.21 19.21 0.00 2.7919 0.6388 573505.90 573505.90 0.00% 42544.95 42544.95
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 20.17% 3.87 0 15 14990.04 12798 21752 13588.91 0 21535 58062 58062 0.00%
crit 79.83% 15.33 4 24 33614.03 26875 47443 33673.29 30851 42684 515444 515444 0.00%

Action Details: Shifting Power

  • id:382440
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:12500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:382440
  • name:Shifting Power
  • school:arcane
  • tooltip:Every {$t1=1} sec, deal {$382445s1=0 + 61.0%} Nature damage to enemies within {$382445=}A1 yds and reduce the remaining cooldown of your abilities by {$=}{-{$s2=3000}/1000} sec.
  • description:Draw power from the Night Fae, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:382445
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.609960
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:382445
  • name:Shifting Power
  • school:arcane
  • tooltip:
  • description:{$@spelldesc382440=Draw power from the Night Fae, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    st
    [N]:4.83
  • if_expr:cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)|cooldown.icy_veins.remains<20
Tindral's Fowl Fantasia 0 (4508) 0.0% (2.1%) 8.8 30.90s 154519 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2203 1.0% 17.5 14.70s 37807 0 Direct 17.5 28605 57180 37808 32.2%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.48 17.48 0.00 0.00 0.00 0.0000 0.0000 660842.56 660842.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.80% 11.85 2 36 28604.62 27980 33359 28594.94 27980 31578 338980 338980 0.00%
crit 32.20% 5.63 0 21 57180.47 55959 66718 56851.01 0 66414 321863 321863 0.00%

Action Details: Denizen Of The Flame

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22445.63
  • base_dd_max:22445.63
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (Final) 2305 1.1% 8.7 30.87s 79520 0 Direct 8.7 60097 120099 79515 32.4%

Stats Details: Denizen Of The Flame Final

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 8.70 0.00 0.00 0.00 0.0000 0.0000 691703.76 691703.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.63% 5.88 0 16 60097.40 58801 70106 60044.60 0 70106 353542 353542 0.00%
crit 32.37% 2.82 0 12 120099.07 117603 140212 113829.05 0 140212 338161 338161 0.00%

Action Details: Denizen Of The Flame Final

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47172.27
  • base_dd_max:47172.27
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
pet - water_elemental 10476 / 5081
Water Jet 2999 0.7% 9.1 33.43s 47900 18106 Periodic 43.1 7628 15245 10071 32.1% 6.3%

Stats Details: Water Jet

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.06 0.00 43.09 43.09 0.00 2.6456 0.4389 433959.66 433959.66 0.00% 18105.79 18105.79
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 67.93% 29.27 14 46 7628.03 6414 10418 7624.34 7117 8357 223268 223268 0.00%
crit 32.07% 13.82 3 28 15245.37 12828 20835 15240.41 13975 16824 210691 210691 0.00%

Action Details: Water Jet

  • id:135029
  • school:frost
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.415600
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$=}w1 damage every {$t1=1} sec.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by {$m2=0}% and ][]dealing {$=}o1 Frost damage to the target over {$d=4 seconds}. Water Jet automatically activates Brain Freeze.

Action Priority List

    default
    [ ]:9.37
Waterbolt 7477 1.7% 87.3 3.17s 12392 9271 Direct 86.9 9431 18848 12459 32.2%

Stats Details: Waterbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 87.34 86.87 0.00 0.00 0.00 1.3366 0.0000 1082353.36 1082353.36 0.00% 9271.09 9271.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.84% 58.94 36 86 9430.51 7864 12646 9428.75 8942 10005 555793 555793 0.00%
crit 32.16% 27.94 11 48 18847.89 15572 25292 18846.54 17669 20659 526560 526560 0.00%

Action Details: Waterbolt

  • id:31707
  • school:frost
  • range:45.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.504500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals $sw1 Frost damage to the target.

Action Priority List

    default
    [ ]:89.56
Simple Action Stats Execute Interval
Rakshasâ
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rakshasâ
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Tepid Versatility 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rakshasâ
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rakshasâ
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Icy Veins 3.5 100.34s

Stats Details: Icy Veins

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Icy Veins

  • id:12472
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.

Action Priority List

    cds
    [F]:3.45
Elemental Potion of Ultimate Power 1.5 300.49s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [D]:1.49
  • if_expr:prev_off_gcd.icy_veins|fight_remains<60
Time Warp 1.3 259.42s

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.33 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by {$=}w1%. {$?=}{$=}W4>0[Time rate increased by {$=}w4%.][]{$?=}{$=}W3=1[ When the effect ends, all affected players are frozen in time for {$356346d=8 seconds}.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% {$?a320919=false}[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.{$?a320920=false}[ When the effect ends, all affected players are frozen in time for {$356346d=8 seconds}.][]

Action Priority List

    cds
    [C]:1.33
  • if_expr:buff.exhaustion.up&talent.temporal_warp&buff.bloodlust.down&(prev_off_gcd.icy_veins|(buff.icy_veins.up&fight_remains<=110|buff.icy_veins.up&fight_remains>=280)|fight_remains<40)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Annihilating Flame 12.2 1.1 23.5s 21.4s 2.7s 10.78% 0.00% 1.1 (1.1) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_annihilating_flame
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:137182.66
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 104.5s
  • trigger_min/max:0.0s / 104.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:2.62% / 25.62%

Stack Uptimes

  • annihilating_flame_1:10.78%

Spelldata

  • id:426553
  • name:Annihilating Flame
  • tooltip:Your critical strikes deal {$423124=}w2% additional damage as Fire split between nearby enemies. {$=}{{$=}w2} additional damage remaining.
  • description:{$@spelldesc423124=Your spells and abilities have a low chance to grant Annihilating Flame for {$426553d=20 seconds}, causing your critical strikes to deal {$s2=50}% additional damage as Fire split between nearby enemies. The Flame may deal {$=}{{$s1=34958}*(1+{$@=}versadmg)} total damage before fading, further increased by critical strikes. Damage and cap increased per enemy struck, up to 5.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.2 0.9 113.7s 70.7s 45.8s 33.27% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.8s / 346.4s
  • trigger_min/max:12.0s / 343.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 298.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_1:33.27%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (Empowered) 2.8 0.0 70.7s 70.7s 10.8s 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_aerwynn_empowered
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.0s / 343.0s
  • trigger_min/max:12.0s / 343.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.09%

Stack Uptimes

  • best_friends_with_aerwynn_empowered_1:0.89%
  • best_friends_with_aerwynn_empowered_2:0.89%
  • best_friends_with_aerwynn_empowered_3:0.89%
  • best_friends_with_aerwynn_empowered_4:0.90%
  • best_friends_with_aerwynn_empowered_5:0.90%
  • best_friends_with_aerwynn_empowered_6:0.90%
  • best_friends_with_aerwynn_empowered_7:0.90%
  • best_friends_with_aerwynn_empowered_8:0.91%
  • best_friends_with_aerwynn_empowered_9:0.91%
  • best_friends_with_aerwynn_empowered_10:0.91%
  • best_friends_with_aerwynn_empowered_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.2 0.9 114.3s 71.0s 45.7s 33.17% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.7s / 358.1s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 304.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_1:33.17%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (Empowered) 2.8 0.0 71.0s 71.0s 10.8s 9.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_pip_empowered
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.0s / 336.0s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.85%

Stack Uptimes

  • best_friends_with_pip_empowered_1:0.88%
  • best_friends_with_pip_empowered_2:0.89%
  • best_friends_with_pip_empowered_3:0.89%
  • best_friends_with_pip_empowered_4:0.89%
  • best_friends_with_pip_empowered_5:0.90%
  • best_friends_with_pip_empowered_6:0.90%
  • best_friends_with_pip_empowered_7:0.90%
  • best_friends_with_pip_empowered_8:0.91%
  • best_friends_with_pip_empowered_9:0.91%
  • best_friends_with_pip_empowered_10:0.91%
  • best_friends_with_pip_empowered_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.2 0.9 115.2s 70.6s 46.3s 33.56% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.7s / 337.9s
  • trigger_min/max:12.0s / 330.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_1:33.56%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (Empowered) 2.8 0.0 70.6s 70.6s 10.8s 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_best_friends_with_urctos_empowered
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:272.79

Trigger Details

  • interval_min/max:12.0s / 330.5s
  • trigger_min/max:12.0s / 330.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 41.37%

Stack Uptimes

  • best_friends_with_urctos_empowered_1:0.89%
  • best_friends_with_urctos_empowered_2:0.89%
  • best_friends_with_urctos_empowered_3:0.90%
  • best_friends_with_urctos_empowered_4:0.90%
  • best_friends_with_urctos_empowered_5:0.90%
  • best_friends_with_urctos_empowered_6:0.90%
  • best_friends_with_urctos_empowered_7:0.91%
  • best_friends_with_urctos_empowered_8:0.91%
  • best_friends_with_urctos_empowered_9:0.91%
  • best_friends_with_urctos_empowered_10:0.92%
  • best_friends_with_urctos_empowered_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Chilling 1.6 353.7 164.2s 0.8s 181.5s 99.64% 0.00% 338.9 (339.0) 0.6

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_bone_chilling
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:55.9s / 356.7s
  • trigger_min/max:0.0s / 12.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.3s
  • uptime_min/max:98.04% / 99.83%

Stack Uptimes

  • bone_chilling_1:0.18%
  • bone_chilling_2:0.04%
  • bone_chilling_3:0.19%
  • bone_chilling_4:1.12%
  • bone_chilling_5:0.39%
  • bone_chilling_6:0.29%
  • bone_chilling_7:0.37%
  • bone_chilling_8:0.36%
  • bone_chilling_9:0.39%
  • bone_chilling_10:96.32%

Spelldata

  • id:205766
  • name:Bone Chilling
  • tooltip:Spell damage done increased by {$=}{{$=}W1}.1%.
  • description:{$@spelldesc205027=Whenever you attempt to chill a target, you gain Bone Chilling, increasing spell damage you deal by {$=}{{$m1=5}/10}.1% for {$205766d=8 seconds}, stacking up to {$205766u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Brain Freeze 34.0 5.0 8.8s 7.7s 3.4s 37.81% 76.25% 5.0 (5.0) 0.1

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • brain_freeze_1:37.81%

Spelldata

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry is instant cast{$?a231584=true}[,][ and] deals {$s2=50}% increased damage{$?a231584=true}[, and will apply Winter's Chill on the target][].
  • description:{$@spelldesc190447=Frostbolt has a {$m1=25}% chance to reset the remaining cooldown on Flurry and cause your next Flurry to deal {$190446s2=50}% increased damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Cryopathy 7.0 57.5 45.0s 4.6s 42.0s 98.04% 0.00% 10.0 (28.5) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_cryopathy
  • max_stacks:10
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 87.9s
  • trigger_min/max:0.0s / 64.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 86.0s
  • uptime_min/max:92.53% / 99.32%

Stack Uptimes

  • cryopathy_1:4.80%
  • cryopathy_2:6.11%
  • cryopathy_3:4.25%
  • cryopathy_4:4.75%
  • cryopathy_5:4.89%
  • cryopathy_6:5.11%
  • cryopathy_7:8.52%
  • cryopathy_8:11.22%
  • cryopathy_9:11.98%
  • cryopathy_10:36.40%

Spelldata

  • id:417492
  • name:Cryopathy
  • tooltip:The damage of your next Ray of Frost is increased by {$=}w1%.
  • description:{$@spelldesc417491=Each time you consume Fingers of Frost the damage of your next Ray of Frost is increased by {$417492s1=5}%, stacking up to {$=}{{$417492s1=5}*{$417492u=10}}%. Icy Veins grants {$417492u=10} stacks instantly.}
  • max_stacks:10
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.5s 300.5s 27.5s 13.36% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 302.9s
  • trigger_min/max:300.0s / 302.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.12%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.36%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fingers of Frost 36.7 37.8 8.1s 3.9s 3.1s 37.37% 67.45% 13.0 (13.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 67.7s
  • trigger_min/max:0.0s / 64.4s
  • trigger_pct:17.13%
  • duration_min/max:0.0s / 30.6s
  • uptime_min/max:25.44% / 53.65%

Stack Uptimes

  • fingers_of_frost_1:25.86%
  • fingers_of_frost_2:11.51%

Spelldata

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt has a {$s1=15}% chance and Frozen Orb damage has a {$s2=10}% to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Freezing Winds 6.0 0.0 53.0s 53.0s 11.8s 23.44% 0.00% 17.6 (17.6) 5.8

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_freezing_winds
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:48.0s / 89.3s
  • trigger_min/max:48.0s / 89.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:19.92% / 26.50%

Stack Uptimes

  • freezing_winds_1:23.44%

Spelldata

  • id:382106
  • name:Freezing Winds
  • tooltip:Gaining Fingers of Frost every {$t1=3} sec.
  • description:{$@spelldesc382103=While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Frigid Empowerment 3.4 133.2 100.4s 2.1s 41.4s 47.77% 0.00% 119.4 (119.4) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_frigid_empowerment
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:95.5s / 112.1s
  • trigger_min/max:0.0s / 72.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.5s
  • uptime_min/max:40.64% / 57.54%

Stack Uptimes

  • frigid_empowerment_2:0.66%
  • frigid_empowerment_3:0.65%
  • frigid_empowerment_4:0.65%
  • frigid_empowerment_5:45.81%

Spelldata

  • id:417488
  • name:Frigid Empowerment
  • tooltip:Your elemental is empowering you increasing your Frost damage dealt by {$s1=3}%.
  • description:{$@spelldesc417487=Your water elemental's abilities apply Frigid Empowerment increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icicles 40.1 169.5 7.6s 1.4s 6.9s 92.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_icicles
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.9s / 19.1s
  • trigger_min/max:0.0s / 12.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s
  • uptime_min/max:85.47% / 98.03%

Stack Uptimes

  • icicles_1:15.61%
  • icicles_2:13.39%
  • icicles_3:14.60%
  • icicles_4:11.78%
  • icicles_5:36.74%

Spelldata

  • id:205473
  • name:Icicles
  • tooltip:{$=}w1 |4Icicle:Icicles; stored.
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched.{$?a321684=true}[ Increases the damage of Frozen Orb, Blizzard, and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.][]}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins 3.5 0.0 100.3s 100.3s 42.0s 48.50% 0.00% 0.0 (0.0) 3.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 112.0s
  • trigger_min/max:96.0s / 112.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.0s
  • uptime_min/max:41.44% / 58.26%

Stack Uptimes

  • icy_veins_1:48.50%

Spelldata

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.
  • max_stacks:0
  • duration:25.00
  • cooldown:120.00
  • default_chance:0.00%
Incanter's Flow 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_incanters_flow
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • incanters_flow_1:20.00%
  • incanters_flow_2:20.00%
  • incanters_flow_3:20.00%
  • incanters_flow_4:20.00%
  • incanters_flow_5:20.00%

Spelldata

  • id:116267
  • name:Incanter's Flow
  • tooltip:Increases spell damage by {$=}w1%.
  • description:{$@spelldesc1463=Magical energy flows through you while in combat, building up to {$=}{{$116267m1=2}*5}% increased damage and then diminishing down to {$116267s1=2}% increased damage, cycling every 10 sec.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Overflowing Energy 42.1 8.3 7.1s 5.9s 0.7s 9.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_overflowing_energy
  • max_stacks:5
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 64.1s
  • trigger_min/max:0.0s / 64.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.4s
  • uptime_min/max:3.18% / 20.34%

Stack Uptimes

  • overflowing_energy_1:7.75%
  • overflowing_energy_2:1.37%
  • overflowing_energy_3:0.37%
  • overflowing_energy_4:0.10%
  • overflowing_energy_5:0.03%

Spelldata

  • id:394195
  • name:Overflowing Energy
  • tooltip:Spell critical strike chance increased by {$=}w1%.
  • description:{$@spelldesc390218=Your spell critical strike damage is increased by {$s1=10}%. When your direct damage spells fail to critically strike a target, your spell critical strike chance is increased by {$394195s1=2}%, up to {$=}{{$394195u=5}*{$394195s1=2}}% for {$394195d=8 seconds}. When your spells critically strike Overflowing Energy is reset.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Ray of Frost 6.1 24.1 52.9s 9.3s 2.5s 5.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_ray_of_frost
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.7s / 85.7s
  • trigger_min/max:0.5s / 83.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:4.23% / 5.95%

Stack Uptimes

  • ray_of_frost_1:1.27%
  • ray_of_frost_2:1.27%
  • ray_of_frost_3:1.26%
  • ray_of_frost_4:1.26%

Spelldata

  • id:208141
  • name:Ray of Frost
  • tooltip:Ray of Frost's damage increased by {$s1=10}%. Ray of Frost's snare increased by {$s2=10}%.
  • description:{$@spelldesc205021=Channel an icy beam at the enemy for {$d=5 seconds}, dealing {$s2=0} Frost damage every {$t2=1} sec and slowing movement by {$s4=60}%. Each time Ray of Frost deals damage, its damage and snare increases by {$208141s1=10}%. Generates {$s3=2} charges of Fingers of Frost over its duration.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Roused Shadowflame 7.5 28.4 41.7s 8.3s 33.0s 82.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_roused_shadowflame
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.1s / 108.6s
  • trigger_min/max:3.0s / 47.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 98.5s
  • uptime_min/max:66.59% / 93.39%

Stack Uptimes

  • roused_shadowflame_1:17.10%
  • roused_shadowflame_2:16.95%
  • roused_shadowflame_3:16.52%
  • roused_shadowflame_4:16.17%
  • roused_shadowflame_5:15.92%

Spelldata

  • id:406887
  • name:Roused Shadowflame
  • tooltip:The Shadowflame stirs, increasing the damage of Roiling Shadowflame by {$=}w1%.
  • description:{$@spelldesc406254=Dealing damage has a chance to rouse the Shadowflame, inflicting {$s2=867} Shadowflame damage upon your target and {$s3=116} Shadowflame damage to yourself. Whenever this happens, you gain a stack of Roused Shadowflame. Roused Shadowflame increases this effects damage by {$s4=20}%, stacking {$406887u=5} times. Upon reaching maximum stacks, the Roused Shadowflame will subside.}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Slick Ice 3.4 22.9 95.5s 10.2s 34.3s 39.26% 0.00% 9.8 (9.8) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_slick_ice
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:61.1s / 140.2s
  • trigger_min/max:0.8s / 115.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.3s
  • uptime_min/max:20.09% / 52.17%

Stack Uptimes

  • slick_ice_1:7.90%
  • slick_ice_2:6.41%
  • slick_ice_3:5.68%
  • slick_ice_4:4.85%
  • slick_ice_5:14.42%

Spelldata

  • id:382148
  • name:Slick Ice
  • tooltip:Cast time of Frostbolt reduced by {$s1=4}% and its damage is increased by {$s2=4}%.
  • description:{$@spelldesc382144=While Icy Veins is active, each Frostbolt you cast reduces the cast time of Frostbolt by {$382148s1=4}% and increases its damage by {$382148s2=4}%, stacking up to {$382148u=5} times.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.0s 45.7s 16.5s 23.67% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 210.0s
  • trigger_min/max:0.0s / 210.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 92.6s
  • uptime_min/max:4.85% / 59.82%

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.3 0.0 259.8s 259.8s 39.3s 17.12% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.0s / 277.1s
  • trigger_min/max:252.0s / 277.1s
  • trigger_pct:100.00%
  • duration_min/max:14.8s / 40.0s
  • uptime_min/max:12.46% / 24.06%

Stack Uptimes

  • temporal_warp_1:17.12%

Spelldata

  • id:386540
  • name:Temporal Warp
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Brain Freeze 39.0 22.0 60.0 7.7s 0.0s 71.8s
Brain Freeze from Frostbolt 14.3 4.0 28.0 19.9s 0.8s 167.5s
Brain Freeze from Glacial Spike 15.7 4.0 30.0 18.1s 3.6s 186.4s
Brain Freeze from Water Jet 9.1 7.0 12.0 33.5s 20.5s 90.5s
Fingers of Frost 74.6 49.0 109.0 4.2s 0.0s 64.4s
Fingers of Frost from Flash Freeze 10.3 1.0 25.0 29.0s 0.0s 260.5s
Fingers of Frost from Freezing Winds 23.3 17.0 28.0 12.0s 3.0s 80.3s
Fingers of Frost from Frostbolt 8.9 0.0 24.0 30.0s 0.8s 278.0s
Fingers of Frost from Frozen Orb Initial Impact 5.9 5.0 7.0 53.0s 48.0s 89.3s
Fingers of Frost from Frozen Orb Tick 14.0 1.0 34.0 19.4s 0.5s 212.9s
Fingers of Frost from Ray of Frost 12.1 10.0 14.0 24.3s 1.0s 84.7s
Fingers of Frost wasted due to Winter's Chill 36.1 19.0 59.0 8.1s 0.8s 100.2s
Flurry cast 44.0 31.0 60.0 6.9s 2.3s 34.1s
Icicles generated 209.6 165.0 266.0 1.7s 0.0s 12.0s
Icicles overflowed 10.6 1.0 28.0 28.8s 0.0s 285.4s
Winter's Chill stacks applied 263.1 186.0 356.0 2.3s 0.2s 33.6s
Winter's Chill stacks consumed 122.3 84.0 168.0 2.4s 0.0s 32.8s
Winter's Chill stacks consumed by Frostbolt 27.2 14.0 43.0 11.1s 3.0s 98.1s
Winter's Chill stacks consumed by Glacial Spike 33.9 21.0 48.0 8.7s 3.6s 57.7s
Winter's Chill stacks consumed by Ice Lance 61.3 38.0 92.0 4.9s 0.8s 56.6s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.97% 21.08% 32.56% 1.0s 0.0s 5.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Frozen Orb4.3870.00030.05126.31910.13367.597
Comet Storm3.7490.00031.07541.03112.69986.694
Shifting Power6.5400.00065.02434.1448.91283.412
Flurry1.2470.00020.56355.2885.372145.161
Time Warp60.9370.00099.05080.99540.01499.050
Icy Veins0.7630.0003.2222.6361.1306.685
Ray of Frost3.0900.00028.69018.9293.83163.601

Shatter

None Winter's Chill Fingers of Frost Other effects
Ability Count Percent Count Percent Utilization Count Percent Count Percent
(frostbolt_) Icicle2.699.2%0.00.3%0.0%0.00.4%
(flurry_) Icicle3.7100.0%
(ice_lance_) Icicle4.198.9%0.01.1%0.1%
Frostbolt18.940.0%27.257.3%61.8%1.32.8%
Glacial Spike5.213.3%33.986.7%77.0%
Ice Lance0.10.1%61.367.8%139.5%24.927.5%4.14.6%
Thermal Void extension36.971.8%84.0%10.620.5%3.97.7%

Icy Veins

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Rakshasâ
Mana RegenMana801.01815373.65100.00%1017.93682404.5645.56%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 245000.0 2717.81 2727.01 682391.8 247237.6 232515.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
Rakshasâ
Comet StormMana 10.8327064.553.31%2500.002499.99102.52
FlurryMana 43.97109922.5513.44%2500.002499.9241.86
FrostboltMana 47.55237751.0729.06%5000.005107.3311.65
Frozen OrbMana 5.9614895.571.82%2500.002500.0187.96
Glacial SpikeMana 39.1797931.7011.97%2500.002499.96285.44
Ice LanceMana 90.62226553.9127.69%2500.002499.9748.17
Ray of FrostMana 6.0730364.743.71%5000.004999.95248.58
Shifting PowerMana 4.8360357.757.38%12500.0012500.359.50
Time WarpMana 1.3313293.691.62%10000.009998.020.00

Statistics & Data Analysis

Fight Length
Rakshasâ Fight Length
Count 9999
Mean 300.02
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Rakshasâ Damage Per Second
Count 9999
Mean 217213.89
Minimum 193898.91
Maximum 239676.01
Spread ( max - min ) 45777.10
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 6558.0103
5th Percentile 206430.81
95th Percentile 228019.65
( 95th Percentile - 5th Percentile ) 21588.83
Mean Distribution
Standard Deviation 65.5834
95.00% Confidence Interval ( 217085.35 - 217342.43 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3502
0.1 Scale Factor Error with Delta=300 367137
0.05 Scale Factor Error with Delta=300 1468547
0.01 Scale Factor Error with Delta=300 36713675
Priority Target DPS
Rakshasâ Priority Target Damage Per Second
Count 9999
Mean 217213.89
Minimum 193898.91
Maximum 239676.01
Spread ( max - min ) 45777.10
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 6558.0103
5th Percentile 206430.81
95th Percentile 228019.65
( 95th Percentile - 5th Percentile ) 21588.83
Mean Distribution
Standard Deviation 65.5834
95.00% Confidence Interval ( 217085.35 - 217342.43 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3502
0.1 Scale Factor Error with Delta=300 367137
0.05 Scale Factor Error with Delta=300 1468547
0.01 Scale Factor Error with Delta=300 36713675
DPS(e)
Rakshasâ Damage Per Second (Effective)
Count 9999
Mean 217213.89
Minimum 193898.91
Maximum 239676.01
Spread ( max - min ) 45777.10
Range [ ( max - min ) / 2 * 100% ] 10.54%
Damage
Rakshasâ Damage
Count 9999
Mean 63614284.29
Minimum 48387368.00
Maximum 82188033.65
Spread ( max - min ) 33800665.65
Range [ ( max - min ) / 2 * 100% ] 26.57%
DTPS
Rakshasâ Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Rakshasâ Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Rakshasâ Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Rakshasâ Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Rakshasâ Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Rakshasâ Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
RakshasâTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Rakshasâ Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 snapshot_stats
5 0.00 blizzard,if=active_enemies>=2&talent.ice_caller|active_enemies>=3
6 0.00 frostbolt,if=active_enemies<=2
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell
7 0.00 call_action_list,name=cds
8 0.00 run_action_list,name=aoe,if=active_enemies>=7&!set_bonus.tier30_2pc|active_enemies>=3&talent.ice_caller
9 0.00 run_action_list,name=cleave,if=active_enemies=2
A 0.00 run_action_list,name=st
actions.cds
# count action,conditions
C 1.33 time_warp,if=buff.exhaustion.up&talent.temporal_warp&buff.bloodlust.down&(prev_off_gcd.icy_veins|(buff.icy_veins.up&fight_remains<=110|buff.icy_veins.up&fight_remains>=280)|fight_remains<40)
0.00 use_item,name=spoils_of_neltharus,if=buff.spoils_of_neltharus_mastery.up|buff.spoils_of_neltharus_haste.up&buff.bloodlust.down&buff.temporal_warp.down&time>0|buff.spoils_of_neltharus_vers.up&(buff.bloodlust.up|buff.temporal_warp.up)
D 1.49 potion,if=prev_off_gcd.icy_veins|fight_remains<60
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,if=(equipped.nymues_unraveling_spindle&prev_gcd.1.nymues_unraveling_spindle)|fight_remains>2
0.00 use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=(gcd.remains>gcd.max-0.1|fight_remains<5)&time>5
0.00 use_item,name=balefire_branch,if=(!talent.ray_of_frost&active_enemies<=2&buff.icy_veins.up&prev_gcd.1.glacial_spike|remaining_winters_chill=1&cooldown.ray_of_frost.up&time>1&active_enemies<=2|cooldown.cone_of_cold.up&prev_gcd.1.comet_storm&active_enemies>=3)|fight_remains<20
E 1.00 flurry,if=time=0&active_enemies<=2
F 3.45 icy_veins
0.00 use_items,if=!equipped.balefire_branch|time>5
0.00 invoke_external_buff,name=power_infusion,if=buff.power_infusion.down
0.00 invoke_external_buff,name=blessing_of_summer,if=buff.blessing_of_summer.down
0.00 blood_fury
0.00 berserking
0.00 lights_judgment
0.00 fireblood
0.00 ancestral_call
actions.st
# count action,conditions
H 10.83 comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
I 42.97 flurry,if=cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&((prev_gcd.1.frostbolt&buff.icicles.react>=3|prev_gcd.1.frostbolt&buff.brain_freeze.react)|prev_gcd.1.glacial_spike|talent.glacial_spike&buff.icicles.react=4&!buff.fingers_of_frost.react)
J 6.29 ice_lance,if=talent.glacial_spike&debuff.winters_chill.down&buff.icicles.react=4&buff.fingers_of_frost.react
K 6.07 ray_of_frost,if=remaining_winters_chill=1
L 32.84 glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
M 5.96 frozen_orb,if=buff.fingers_of_frost.react<2&(!talent.ray_of_frost|cooldown.ray_of_frost.remains)
0.00 cone_of_cold,if=talent.coldest_snap&cooldown.comet_storm.remains>10&cooldown.frozen_orb.remains>10&remaining_winters_chill=0&active_enemies>=3
0.00 blizzard,if=active_enemies>=2&talent.ice_caller&talent.freezing_rain&(!talent.splintering_cold&!talent.ray_of_frost|buff.freezing_rain.up|active_enemies>=3)
N 4.83 shifting_power,if=cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)|cooldown.icy_veins.remains<20
O 6.56 glacial_spike,if=buff.icicles.react=5
P 84.33 ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
0.00 ice_nova,if=active_enemies>=4
Q 46.75 frostbolt
R 0.00 call_action_list,name=movement

Sample Sequence

0126EFDHPKPLIMNPPJLIPPILPQPQIHLPQIPLQIPPLIPPQILPQQILPQIPPLIHPKPMPJLIPPNPJLIHPPQOQQQOQPQIFCLPQIPLQIPKPJLIHMPPQJOQPPQILPPPQILPQINPLQQIHPLQIPLQPPQQOIPKPMPJOQIHPPOQPQQOIPPQILNFPQIHPPLIPPQILKPMPPQILPPQIPLQIHPPLIPPQILPQQIPLQIPPOQQQQOQIHPKJLIMNPPPIHLPPQILPQIP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Rakshasâ 250000.0/250000: 100% mana incanters_flow
Pre precombat 1 food Rakshasâ 250000.0/250000: 100% mana incanters_flow
Pre precombat 2 augmentation Rakshasâ 250000.0/250000: 100% mana incanters_flow
Pre precombat 6 frostbolt Fluffy_Pillow 250000.0/250000: 100% mana incanters_flow
0:00.000 cds E flurry Fluffy_Pillow 245000.0/250000: 98% mana icicles(2), incanters_flow
0:01.135 cds F icy_veins Fluffy_Pillow 248175.0/250000: 99% mana bloodlust, bone_chilling(4), icicles(3), incanters_flow(2)
0:01.135 cds D potion Fluffy_Pillow 248175.0/250000: 99% mana bloodlust, bone_chilling(4), cryopathy(10), icicles(3), icy_veins, incanters_flow(2)
0:01.135 st H comet_storm Fluffy_Pillow 248175.0/250000: 99% mana bloodlust, bone_chilling(4), cryopathy(10), icicles(3), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:01.890 st P ice_lance Fluffy_Pillow 249450.0/250000: 100% mana bloodlust, bone_chilling(4), brain_freeze, cryopathy(10), frigid_empowerment(2), icicles(3), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:02.644 st K ray_of_frost Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(4), brain_freeze, cryopathy(10), frigid_empowerment(4), icicles(4), icy_veins, incanters_flow(3), elemental_potion_of_ultimate_power
0:05.321 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, fingers_of_frost(2), frigid_empowerment(5), icicles(4), icy_veins, incanters_flow(5), annihilating_flame, elemental_potion_of_ultimate_power
0:06.075 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, incanters_flow(4), annihilating_flame, elemental_potion_of_ultimate_power
0:07.407 st I flurry Fluffy_Pillow 247525.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, frigid_empowerment(5), icy_veins, incanters_flow(3), annihilating_flame, elemental_potion_of_ultimate_power
0:08.161 st M frozen_orb Fluffy_Pillow 248795.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:08.916 st N shifting_power Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:11.112 st P ice_lance Fluffy_Pillow 248480.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:11.865 st P ice_lance Fluffy_Pillow 249745.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(2), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, incanters_flow(2), elemental_potion_of_ultimate_power
0:12.621 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(3), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(4), icy_veins, incanters_flow(3), elemental_potion_of_ultimate_power
0:13.376 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(4), freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, incanters_flow(4), elemental_potion_of_ultimate_power
0:14.709 st I flurry Fluffy_Pillow 247530.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(4), fingers_of_frost, freezing_winds, frigid_empowerment(5), icy_veins, incanters_flow(5), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(11), elemental_potion_of_ultimate_power
0:15.462 st P ice_lance Fluffy_Pillow 248795.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, incanters_flow(5), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(10), elemental_potion_of_ultimate_power
0:16.215 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(5), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, incanters_flow(4), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(9), elemental_potion_of_ultimate_power
0:16.968 st I flurry Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(6), freezing_winds, frigid_empowerment(5), icicles(4), icy_veins, incanters_flow(4), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(9), elemental_potion_of_ultimate_power
0:17.723 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(6), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, incanters_flow(3), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(8), elemental_potion_of_ultimate_power
0:19.056 st P ice_lance Fluffy_Pillow 247530.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(6), fingers_of_frost, freezing_winds, frigid_empowerment(5), icy_veins, incanters_flow, roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(7), elemental_potion_of_ultimate_power
0:19.810 st Q frostbolt Fluffy_Pillow 248800.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(7), freezing_winds, frigid_empowerment(5), icicles, icy_veins, incanters_flow, roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(6), elemental_potion_of_ultimate_power
0:20.780 st P ice_lance Fluffy_Pillow 245025.0/250000: 98% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(7), fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, slick_ice, incanters_flow, roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(5), elemental_potion_of_ultimate_power
0:21.535 st Q frostbolt Fluffy_Pillow 246300.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icicles(3), icy_veins, slick_ice, incanters_flow(2), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(4), elemental_potion_of_ultimate_power
0:22.466 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(2), incanters_flow(3), overflowing_energy, roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(3), elemental_potion_of_ultimate_power
0:23.222 st H comet_storm Fluffy_Pillow 246305.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(2), incanters_flow(4), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(2), elemental_potion_of_ultimate_power
0:23.976 st L glacial_spike Fluffy_Pillow 247575.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(2), incanters_flow(4), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(2), elemental_potion_of_ultimate_power
0:25.308 st P ice_lance Fluffy_Pillow 247525.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(8), fingers_of_frost, frigid_empowerment(5), icy_veins, slick_ice(2), incanters_flow(5), roused_shadowflame(2), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:26.063 st Q frostbolt Fluffy_Pillow 248800.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(9), frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(4), roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:26.954 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(9), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(3), incanters_flow(4), roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:27.709 st P ice_lance Fluffy_Pillow 246295.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(9), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(3), incanters_flow(3), roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:28.465 st L glacial_spike Fluffy_Pillow 247575.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(9), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(3), incanters_flow(2), roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:29.795 st Q frostbolt Fluffy_Pillow 247515.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(9), fingers_of_frost, frigid_empowerment(5), icy_veins, slick_ice(3), incanters_flow, roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:30.650 st I flurry Fluffy_Pillow 245030.0/250000: 98% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(9), fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(4), incanters_flow, roused_shadowflame(3), best_friends_with_urctos, elemental_potion_of_ultimate_power
0:31.406 st P ice_lance Fluffy_Pillow 246310.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(9), fingers_of_frost, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(4), incanters_flow(2), roused_shadowflame(3), best_friends_with_urctos
0:32.160 st P ice_lance Fluffy_Pillow 247580.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(4), incanters_flow(3), roused_shadowflame(3), best_friends_with_urctos
0:32.915 st L glacial_spike Fluffy_Pillow 248855.0/250000: 100% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(4), incanters_flow(3), roused_shadowflame(3), best_friends_with_urctos
0:34.246 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice(4), incanters_flow(5), roused_shadowflame(4), best_friends_with_urctos
0:35.001 st P ice_lance Fluffy_Pillow 248795.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles, icy_veins, slick_ice(4), incanters_flow(5), roused_shadowflame(4), best_friends_with_urctos
0:35.754 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(4), incanters_flow(5), roused_shadowflame(4), best_friends_with_urctos
0:36.508 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(4), incanters_flow(4), roused_shadowflame(4), annihilating_flame, best_friends_with_urctos
0:37.323 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bloodlust, bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(3), roused_shadowflame(4), annihilating_flame, best_friends_with_urctos
0:38.078 st L glacial_spike Fluffy_Pillow 246300.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(2), overflowing_energy, roused_shadowflame(4), annihilating_flame, best_friends_with_urctos
0:39.409 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bloodlust, bone_chilling(10), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow, roused_shadowflame(4), best_friends_with_urctos
0:40.164 st Q frostbolt Fluffy_Pillow 248795.0/250000: 100% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow, roused_shadowflame(4), best_friends_with_urctos
0:41.172 st Q frostbolt Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow(2), roused_shadowflame(5), best_friends_with_urctos
0:42.182 st I flurry Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(3), overflowing_energy, roused_shadowflame(5), annihilating_flame, best_friends_with_urctos
0:43.127 st L glacial_spike Fluffy_Pillow 247255.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(4), roused_shadowflame(5), annihilating_flame, best_friends_with_urctos
0:44.856 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow(5), roused_shadowflame(5), annihilating_flame, best_friends_with_urctos
0:45.800 st Q frostbolt Fluffy_Pillow 249740.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow(5), roused_shadowflame(5), best_friends_with_urctos
0:46.808 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(5), incanters_flow(4), roused_shadowflame(5), best_friends_with_urctos
0:47.753 st P ice_lance Fluffy_Pillow 247245.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(10), icicles(3), incanters_flow(3), roused_shadowflame(5), best_friends_with_urctos
0:48.887 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), icicles(4), incanters_flow(2), roused_shadowflame(5), best_friends_with_urctos
0:50.021 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), icicles(5), incanters_flow, roused_shadowflame(5), best_friends_with_urctos
0:52.096 st I flurry Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(10), incanters_flow(3), best_friends_with_urctos
0:53.229 st H comet_storm Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles, incanters_flow(4), best_friends_with_urctos
0:54.362 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles, incanters_flow(5), best_friends_with_urctos
0:55.496 st K ray_of_frost Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles(2), incanters_flow(5), roused_shadowflame, best_friends_with_urctos
0:59.362 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), fingers_of_frost(2), icicles(2), incanters_flow, roused_shadowflame, best_friends_with_urctos
1:00.495 st M frozen_orb Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, icicles(3), incanters_flow, roused_shadowflame, best_friends_with_urctos
1:01.628 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, freezing_winds, icicles(3), incanters_flow(2), roused_shadowflame, best_friends_with_urctos
1:02.761 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(2), fingers_of_frost, freezing_winds, icicles(4), incanters_flow(3), roused_shadowflame, best_friends_with_urctos
1:03.894 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(3), fingers_of_frost, freezing_winds, icicles(5), incanters_flow(4), roused_shadowflame, best_friends_with_urctos
1:05.967 st I flurry Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(3), fingers_of_frost, freezing_winds, incanters_flow(5), roused_shadowflame, best_friends_with_urctos
1:07.102 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, icicles, incanters_flow(3), roused_shadowflame, best_friends_with_urctos
1:08.236 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, icicles(2), incanters_flow(2), roused_shadowflame, best_friends_with_urctos
1:09.369 st N shifting_power Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(5), fingers_of_frost, freezing_winds, icicles(3), incanters_flow, roused_shadowflame, best_friends_with_urctos
1:12.584 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(5), fingers_of_frost(2), icicles(3), incanters_flow(3), roused_shadowflame(2), best_friends_with_urctos
1:13.718 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(6), fingers_of_frost, icicles(4), incanters_flow(4), roused_shadowflame(2), best_friends_with_urctos
1:14.851 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(7), icicles(5), incanters_flow(5), roused_shadowflame(2), best_friends_with_urctos
1:16.925 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(7), incanters_flow(4), roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:18.058 st H comet_storm Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(7), icicles(2), incanters_flow(2), roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:19.192 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(7), icicles(2), incanters_flow, roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:20.325 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(7), icicles(3), incanters_flow, roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:21.458 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(7), icicles(4), incanters_flow(2), roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:22.968 st O glacial_spike Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(7), icicles(5), incanters_flow(3), roused_shadowflame(2), best_friends_with_urctos, sophic_devotion
1:25.138 st Q frostbolt Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(7), incanters_flow(5), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(11), sophic_devotion
1:26.647 st Q frostbolt Fluffy_Pillow 245015.0/250000: 98% mana bone_chilling(10), cryopathy(7), icicles(2), incanters_flow(4), overflowing_energy, roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(10), sophic_devotion
1:28.157 st Q frostbolt Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(7), fingers_of_frost, icicles(4), incanters_flow(2), overflowing_energy(2), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(8), sophic_devotion
1:29.668 st O glacial_spike Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), cryopathy(7), fingers_of_frost, icicles(5), incanters_flow, overflowing_energy(3), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(7), sophic_devotion
1:31.838 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), cryopathy(7), fingers_of_frost, incanters_flow(2), overflowing_energy(4), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(5), sophic_devotion
1:33.349 st P ice_lance Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(7), fingers_of_frost, icicles, incanters_flow(4), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(3)
1:34.483 st Q frostbolt Fluffy_Pillow 248195.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(8), icicles(2), incanters_flow(5), overflowing_energy, roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(2)
1:35.994 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(8), icicles(4), incanters_flow(5), overflowing_energy, roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered
1:37.128 cds F icy_veins Fluffy_Pillow 248195.0/250000: 99% mana bone_chilling(10), cryopathy(8), icicles(5), incanters_flow(3), roused_shadowflame(3), annihilating_flame, best_friends_with_urctos
1:37.135 cds C time_warp Fluffy_Pillow 248230.0/250000: 99% mana bone_chilling(10), cryopathy(10), icicles(5), icy_veins, incanters_flow(3), roused_shadowflame(3), annihilating_flame, best_friends_with_urctos
1:37.135 st L glacial_spike Fluffy_Pillow 238230.0/250000: 95% mana bone_chilling(10), cryopathy(10), icicles(5), icy_veins, incanters_flow(3), temporal_warp, roused_shadowflame(3), annihilating_flame, best_friends_with_urctos
1:38.466 st P ice_lance Fluffy_Pillow 242385.0/250000: 97% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(3), icy_veins, incanters_flow(2), temporal_warp, roused_shadowflame(4), annihilating_flame, best_friends_with_urctos
1:39.220 st Q frostbolt Fluffy_Pillow 243655.0/250000: 97% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(4), icicles, icy_veins, incanters_flow, temporal_warp, roused_shadowflame(4), best_friends_with_urctos
1:40.190 st I flurry Fluffy_Pillow 243505.0/250000: 97% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice, incanters_flow, temporal_warp, roused_shadowflame(4), best_friends_with_urctos
1:40.944 st P ice_lance Fluffy_Pillow 244775.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice, incanters_flow, temporal_warp, roused_shadowflame(4), best_friends_with_urctos
1:41.700 st L glacial_spike Fluffy_Pillow 246055.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice, incanters_flow(2), temporal_warp, roused_shadowflame(4), best_friends_with_urctos
1:43.032 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice, incanters_flow(4), temporal_warp, roused_shadowflame(5), best_friends_with_urctos
1:43.963 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(4), temporal_warp, roused_shadowflame(5), best_friends_with_urctos
1:44.718 st P ice_lance Fluffy_Pillow 246300.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(2), incanters_flow(5), temporal_warp, roused_shadowflame(5), annihilating_flame, best_friends_with_urctos
1:45.473 st K ray_of_frost Fluffy_Pillow 247575.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(2), incanters_flow(5), temporal_warp, roused_shadowflame(5), annihilating_flame, best_friends_with_urctos
1:48.192 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), fingers_of_frost(2), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(2), incanters_flow(2), temporal_warp, best_friends_with_urctos
1:48.946 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(2), incanters_flow(2), temporal_warp, best_friends_with_urctos
1:49.701 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(2), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(2), incanters_flow, temporal_warp, best_friends_with_urctos
1:51.031 st I flurry Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(2), fingers_of_frost, frigid_empowerment(5), icy_veins, slick_ice(2), incanters_flow(2), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:51.785 st H comet_storm Fluffy_Pillow 248785.0/250000: 100% mana bone_chilling(10), cryopathy(2), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(2), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:52.537 st M frozen_orb Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(2), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(3), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:53.292 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(2), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(4), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:54.048 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(3), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(2), incanters_flow(5), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:54.801 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(4), freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(2), incanters_flow(5), temporal_warp, roused_shadowflame, best_friends_with_urctos
1:55.693 st J ice_lance Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(3), incanters_flow(5), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
1:56.448 st O glacial_spike Fluffy_Pillow 246300.0/250000: 99% mana bone_chilling(10), cryopathy(5), freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(3), incanters_flow(4), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
1:57.778 st Q frostbolt Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(5), freezing_winds, frigid_empowerment(5), icy_veins, slick_ice(3), incanters_flow(3), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
1:58.631 st P ice_lance Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(5), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles, icy_veins, slick_ice(4), incanters_flow(2), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
1:59.385 st P ice_lance Fluffy_Pillow 246290.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(4), incanters_flow, temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:00.141 st Q frostbolt Fluffy_Pillow 247570.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(7), freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(4), incanters_flow, temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:00.956 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(7), freezing_winds, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow, temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:01.711 st L glacial_spike Fluffy_Pillow 246300.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(7), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(2), overflowing_energy, temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:03.041 st P ice_lance Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(7), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow(4), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:03.796 st P ice_lance Fluffy_Pillow 248790.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(8), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow(4), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:04.553 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(9), fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(5), incanters_flow(5), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:05.308 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow(5), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:06.084 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(4), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:06.838 st L glacial_spike Fluffy_Pillow 246290.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(4), overflowing_energy, temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:08.169 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow(2), temporal_warp, roused_shadowflame(2), annihilating_flame, best_friends_with_urctos
2:08.923 st Q frostbolt Fluffy_Pillow 248790.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow(2), temporal_warp, roused_shadowflame(2), best_friends_with_urctos
2:09.700 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow, temporal_warp, roused_shadowflame(3), best_friends_with_urctos
2:10.457 st N shifting_power Fluffy_Pillow 246310.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow, temporal_warp, roused_shadowflame(3), best_friends_with_urctos
2:12.578 st P ice_lance Fluffy_Pillow 244415.0/250000: 98% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(3), temporal_warp, roused_shadowflame(3), best_friends_with_urctos
2:13.333 st L glacial_spike Fluffy_Pillow 245690.0/250000: 98% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(4), temporal_warp, roused_shadowflame(3), best_friends_with_urctos
2:14.663 st Q frostbolt Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow(5), temporal_warp, roused_shadowflame(4), best_friends_with_urctos
2:15.441 st Q frostbolt Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(5), incanters_flow(5), temporal_warp, roused_shadowflame(4), best_friends_with_urctos
2:16.216 st I flurry Fluffy_Pillow 243905.0/250000: 98% mana bone_chilling(10), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow(4), temporal_warp, roused_shadowflame(4), best_friends_with_urctos
2:16.971 st H comet_storm Fluffy_Pillow 245180.0/250000: 98% mana bone_chilling(10), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(4), overflowing_energy, temporal_warp, roused_shadowflame(4), best_friends_with_urctos
2:17.728 st P ice_lance Fluffy_Pillow 246465.0/250000: 99% mana bone_chilling(10), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(3), roused_shadowflame(4), best_friends_with_urctos
2:18.674 st L glacial_spike Fluffy_Pillow 248695.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(2), roused_shadowflame(5), best_friends_with_urctos
2:20.404 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(10), fingers_of_frost(2), frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow, roused_shadowflame(5), best_friends_with_urctos
2:21.412 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), fingers_of_frost(2), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(5), incanters_flow(2), best_friends_with_urctos
2:22.358 st P ice_lance Fluffy_Pillow 247250.0/250000: 99% mana bone_chilling(10), cryopathy(10), fingers_of_frost(2), frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow(3), best_friends_with_urctos
2:23.301 st L glacial_spike Fluffy_Pillow 249465.0/250000: 100% mana bone_chilling(10), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(4), best_friends_with_urctos
2:25.032 st Q frostbolt Fluffy_Pillow 247530.0/250000: 99% mana bone_chilling(10), cryopathy(10), fingers_of_frost(2), incanters_flow(5), best_friends_with_urctos
2:26.543 st P ice_lance Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), cryopathy(10), fingers_of_frost(2), icicles, incanters_flow(4), roused_shadowflame, annihilating_flame, best_friends_with_urctos, best_friends_with_urctos_empowered(11)
2:27.675 st P ice_lance Fluffy_Pillow 248185.0/250000: 99% mana bone_chilling(10), cryopathy(10), fingers_of_frost, icicles(2), incanters_flow(3), roused_shadowflame, annihilating_flame, best_friends_with_urctos, best_friends_with_urctos_empowered(10)
2:28.807 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles(3), incanters_flow(2), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(9)
2:30.319 st Q frostbolt Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), cryopathy(10), icicles(5), incanters_flow, roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(8)
2:31.829 st O glacial_spike Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(10), icicles(5), incanters_flow(2), overflowing_energy, roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(6)
2:34.000 st I flurry Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), cryopathy(10), incanters_flow(5), overflowing_energy(2), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(4)
2:35.133 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles, incanters_flow(5), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(3)
2:36.267 st K ray_of_frost Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(10), icicles(2), incanters_flow(4), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(2)
2:40.275 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), fingers_of_frost(2), icicles(2), incanters_flow, roused_shadowflame(3), best_friends_with_urctos
2:41.406 st M frozen_orb Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, icicles(3), incanters_flow(2), roused_shadowflame(3), best_friends_with_urctos
2:42.539 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, freezing_winds, icicles(3), incanters_flow(3), roused_shadowflame(3), best_friends_with_urctos
2:43.672 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(2), fingers_of_frost, freezing_winds, icicles(4), incanters_flow(4), roused_shadowflame(3), best_friends_with_urctos
2:44.807 st O glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, icicles(5), incanters_flow(5), roused_shadowflame(3), best_friends_with_urctos
2:46.882 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, incanters_flow(4), roused_shadowflame(4), best_friends_with_urctos
2:48.394 st I flurry Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(3), fingers_of_frost(2), freezing_winds, icicles, incanters_flow(2), roused_shadowflame(4), best_friends_with_urctos
2:49.528 st H comet_storm Fluffy_Pillow 248200.0/250000: 99% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, icicles(3), incanters_flow, roused_shadowflame(5), best_friends_with_urctos
2:50.661 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, icicles(3), incanters_flow, roused_shadowflame(5), best_friends_with_urctos
2:51.795 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, icicles(4), incanters_flow(2), roused_shadowflame(5), best_friends_with_urctos
2:52.927 st O glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(5), freezing_winds, icicles(5), incanters_flow(3), best_friends_with_urctos
2:55.002 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), cryopathy(5), fingers_of_frost, incanters_flow(5), best_friends_with_urctos
2:56.513 st P ice_lance Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), cryopathy(5), fingers_of_frost, icicles, incanters_flow(4), overflowing_energy, best_friends_with_urctos
2:57.646 st Q frostbolt Fluffy_Pillow 248190.0/250000: 99% mana bone_chilling(10), cryopathy(6), icicles(2), incanters_flow(3), overflowing_energy, best_friends_with_urctos
2:59.154 st Q frostbolt Fluffy_Pillow 245010.0/250000: 98% mana bone_chilling(10), cryopathy(6), icicles(4), incanters_flow, overflowing_energy, annihilating_flame, best_friends_with_urctos
3:00.665 st O glacial_spike Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost, icicles(5), incanters_flow, overflowing_energy(2), annihilating_flame, best_friends_with_urctos
3:02.834 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost, incanters_flow(3), annihilating_flame, best_friends_with_urctos
3:03.967 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost, icicles, incanters_flow(4), best_friends_with_urctos
3:05.099 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(7), icicles(2), incanters_flow(5), best_friends_with_urctos
3:06.231 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(7), icicles(3), incanters_flow(4), best_friends_with_urctos
3:07.742 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(7), icicles(4), incanters_flow(3), best_friends_with_urctos
3:08.876 st L glacial_spike Fluffy_Pillow 248195.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(7), icicles(5), incanters_flow(2), best_friends_with_urctos
3:10.950 st N shifting_power Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(7), incanters_flow, best_friends_with_urctos
3:14.233 cds F icy_veins Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(7), incanters_flow(5), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(9)
3:14.233 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), icy_veins, incanters_flow(5), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(9)
3:15.179 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(2), icicles, icy_veins, incanters_flow(5), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(8)
3:16.438 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(10), frigid_empowerment(4), icicles(2), icy_veins, slick_ice, incanters_flow(4), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(7)
3:17.383 st H comet_storm Fluffy_Pillow 247245.0/250000: 99% mana bone_chilling(3), cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice, incanters_flow(3), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(6)
3:18.328 st P ice_lance Fluffy_Pillow 249470.0/250000: 100% mana bone_chilling(4), cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice, incanters_flow(2), roused_shadowflame, best_friends_with_pip, best_friends_with_pip_empowered(5)
3:19.273 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(4), cryopathy(10), frigid_empowerment(5), icicles(4), icy_veins, slick_ice, incanters_flow, roused_shadowflame(2), annihilating_flame, best_friends_with_pip, best_friends_with_pip_empowered(4)
3:20.218 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(4), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice, incanters_flow, roused_shadowflame(2), annihilating_flame, best_friends_with_pip, best_friends_with_pip_empowered(3)
3:21.947 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(4), cryopathy(10), fingers_of_frost, frigid_empowerment(5), icy_veins, slick_ice, incanters_flow(2), roused_shadowflame(2), annihilating_flame, best_friends_with_pip, best_friends_with_pip_empowered
3:22.892 st P ice_lance Fluffy_Pillow 249745.0/250000: 100% mana bone_chilling(6), brain_freeze, cryopathy(10), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, slick_ice, incanters_flow(3), roused_shadowflame(2), best_friends_with_pip
3:23.837 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(7), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(2), icy_veins, slick_ice, incanters_flow(4), roused_shadowflame(2), best_friends_with_pip
3:24.782 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(7), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(3), icy_veins, slick_ice, incanters_flow(5), roused_shadowflame(2), best_friends_with_pip
3:25.989 st I flurry Fluffy_Pillow 245015.0/250000: 98% mana bone_chilling(7), brain_freeze, cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(2), incanters_flow(5), roused_shadowflame(2), best_friends_with_pip
3:26.936 st L glacial_spike Fluffy_Pillow 247250.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(2), incanters_flow(4), roused_shadowflame(3), best_friends_with_pip
3:28.665 st K ray_of_frost Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(10), frigid_empowerment(5), icy_veins, slick_ice(2), incanters_flow(2), roused_shadowflame(3), best_friends_with_pip
3:32.119 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, fingers_of_frost(2), frigid_empowerment(5), icy_veins, slick_ice(2), incanters_flow(3), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(11)
3:33.063 st M frozen_orb Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(4), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(10)
3:34.011 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles, icy_veins, slick_ice(2), incanters_flow(5), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(9)
3:34.958 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(2), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(2), incanters_flow(5), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(8)
3:35.902 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(3), freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(2), incanters_flow(5), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(7)
3:37.061 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(3), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(3), incanters_flow(3), roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(6)
3:38.006 st L glacial_spike Fluffy_Pillow 247250.0/250000: 99% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(3), incanters_flow(2), roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(5)
3:39.735 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(3), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icy_veins, slick_ice(3), incanters_flow, roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(4)
3:40.680 st P ice_lance Fluffy_Pillow 249745.0/250000: 100% mana bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles, icy_veins, slick_ice(3), incanters_flow, roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(3)
3:41.626 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(5), freezing_winds, frigid_empowerment(5), icicles(2), icy_veins, slick_ice(3), incanters_flow(2), roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(2)
3:42.735 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(5), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(3), icy_veins, slick_ice(4), incanters_flow(3), roused_shadowflame(5), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered
3:43.682 st P ice_lance Fluffy_Pillow 247260.0/250000: 99% mana bone_chilling(10), cryopathy(5), fingers_of_frost(2), freezing_winds, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(4), incanters_flow(4), roused_shadowflame(5), best_friends_with_aerwynn
3:44.628 st L glacial_spike Fluffy_Pillow 249490.0/250000: 100% mana bone_chilling(10), cryopathy(6), fingers_of_frost, freezing_winds, frigid_empowerment(5), icicles(5), icy_veins, slick_ice(4), incanters_flow(5), roused_shadowflame(5), best_friends_with_aerwynn
3:46.356 st Q frostbolt Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(6), fingers_of_frost(2), frigid_empowerment(5), icy_veins, slick_ice(4), incanters_flow(4), roused_shadowflame(5), best_friends_with_aerwynn
3:47.416 st I flurry Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost(2), frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow(3), roused_shadowflame(5), best_friends_with_aerwynn
3:48.360 st H comet_storm Fluffy_Pillow 247250.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost(2), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow(2), best_friends_with_aerwynn
3:49.305 st P ice_lance Fluffy_Pillow 249475.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost(2), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow, best_friends_with_aerwynn
3:50.250 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(7), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, slick_ice(5), incanters_flow, best_friends_with_aerwynn, sophic_devotion
3:51.193 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icicles(5), icy_veins, slick_ice(5), incanters_flow(2), best_friends_with_aerwynn, sophic_devotion
3:52.922 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), brain_freeze, cryopathy(8), frigid_empowerment(5), icy_veins, slick_ice(5), incanters_flow(3), annihilating_flame, best_friends_with_aerwynn, sophic_devotion
3:53.868 st P ice_lance Fluffy_Pillow 249750.0/250000: 100% mana bone_chilling(10), cryopathy(8), frigid_empowerment(5), icicles, icy_veins, slick_ice(5), incanters_flow(4), annihilating_flame, best_friends_with_aerwynn, sophic_devotion
3:54.811 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(8), frigid_empowerment(5), icicles(2), icy_veins, slick_ice(5), incanters_flow(5), annihilating_flame, best_friends_with_aerwynn, sophic_devotion
3:55.757 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(8), frigid_empowerment(5), icicles(3), icy_veins, slick_ice(5), incanters_flow(5), best_friends_with_aerwynn, sophic_devotion
3:56.766 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(8), fingers_of_frost, icicles(4), incanters_flow(4), best_friends_with_aerwynn, sophic_devotion
3:57.898 st L glacial_spike Fluffy_Pillow 248185.0/250000: 99% mana bone_chilling(10), cryopathy(8), fingers_of_frost, icicles(5), incanters_flow(3), roused_shadowflame, best_friends_with_aerwynn, sophic_devotion
3:59.972 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(8), fingers_of_frost, incanters_flow, roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(10), sophic_devotion
4:01.105 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles, incanters_flow(2), roused_shadowflame, best_friends_with_urctos, best_friends_with_urctos_empowered(9), sophic_devotion
4:02.614 st Q frostbolt Fluffy_Pillow 245015.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles(2), incanters_flow(3), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(7), sophic_devotion
4:04.124 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles(3), incanters_flow(5), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(6), sophic_devotion
4:05.256 st P ice_lance Fluffy_Pillow 248180.0/250000: 99% mana bone_chilling(10), cryopathy(9), icicles(4), incanters_flow(5), roused_shadowflame(2), best_friends_with_urctos, best_friends_with_urctos_empowered(5)
4:06.391 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles(5), incanters_flow(4), roused_shadowflame(3), best_friends_with_urctos, best_friends_with_urctos_empowered(3)
4:08.466 st Q frostbolt Fluffy_Pillow 247525.0/250000: 99% mana bone_chilling(10), cryopathy(9), incanters_flow(2), roused_shadowflame(3), annihilating_flame, best_friends_with_urctos, best_friends_with_urctos_empowered
4:09.976 st I flurry Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(9), icicles, incanters_flow, roused_shadowflame(3), best_friends_with_urctos
4:11.109 st P ice_lance Fluffy_Pillow 248185.0/250000: 99% mana bone_chilling(10), cryopathy(9), icicles(3), incanters_flow(2), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(11)
4:12.244 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles(4), incanters_flow(3), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(10)
4:13.377 st O glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles(5), incanters_flow(4), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(9)
4:15.451 st Q frostbolt Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(9), incanters_flow(5), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(7)
4:16.961 st Q frostbolt Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles, incanters_flow(4), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(5)
4:18.471 st Q frostbolt Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles(2), incanters_flow(2), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(4)
4:19.982 st Q frostbolt Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles(4), incanters_flow, overflowing_energy, roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(2)
4:21.492 st O glacial_spike Fluffy_Pillow 245020.0/250000: 98% mana bone_chilling(10), cryopathy(9), icicles(5), incanters_flow(2), overflowing_energy(2), roused_shadowflame(4), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered
4:23.661 st Q frostbolt Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(9), incanters_flow(4), overflowing_energy(3), roused_shadowflame(4), best_friends_with_aerwynn
4:25.173 st I flurry Fluffy_Pillow 245030.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(9), icicles(2), incanters_flow(5), overflowing_energy(4), roused_shadowflame(5), best_friends_with_aerwynn
4:26.305 st H comet_storm Fluffy_Pillow 248190.0/250000: 99% mana bone_chilling(10), cryopathy(9), icicles(3), incanters_flow(4), roused_shadowflame(5), best_friends_with_aerwynn
4:27.440 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles(3), incanters_flow(3), roused_shadowflame(5), best_friends_with_aerwynn
4:28.573 st K ray_of_frost Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(9), icicles(4), incanters_flow(2), roused_shadowflame(5), best_friends_with_aerwynn
4:32.683 st J ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), fingers_of_frost(2), icicles(4), incanters_flow(3), best_friends_with_aerwynn
4:33.817 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy, fingers_of_frost, icicles(5), incanters_flow(4), best_friends_with_aerwynn
4:35.891 st I flurry Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy, fingers_of_frost, incanters_flow(5), roused_shadowflame, best_friends_with_aerwynn
4:37.024 st M frozen_orb Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, icicles, incanters_flow(3), roused_shadowflame, best_friends_with_aerwynn
4:38.158 st N shifting_power Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost, freezing_winds, icicles, incanters_flow(2), roused_shadowflame, best_friends_with_aerwynn
4:41.383 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy, fingers_of_frost(2), freezing_winds, icicles, incanters_flow(2), roused_shadowflame, annihilating_flame, best_friends_with_aerwynn
4:42.519 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(2), fingers_of_frost, freezing_winds, icicles(2), incanters_flow(3), roused_shadowflame, best_friends_with_aerwynn
4:43.651 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(3), fingers_of_frost, freezing_winds, icicles(3), incanters_flow(4), roused_shadowflame, best_friends_with_aerwynn
4:44.784 st I flurry Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(4), freezing_winds, icicles(4), incanters_flow(5), roused_shadowflame, best_friends_with_aerwynn
4:45.916 st H comet_storm Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(4), freezing_winds, icicles(5), incanters_flow(5), roused_shadowflame, best_friends_with_aerwynn
4:47.050 st L glacial_spike Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), cryopathy(4), fingers_of_frost, freezing_winds, icicles(5), incanters_flow(3), roused_shadowflame, best_friends_with_aerwynn
4:49.124 st P ice_lance Fluffy_Pillow 247520.0/250000: 99% mana bone_chilling(10), cryopathy(4), fingers_of_frost(2), incanters_flow, roused_shadowflame, best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(11)
4:50.257 st P ice_lance Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(5), fingers_of_frost, icicles, incanters_flow, roused_shadowflame, best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(10)
4:51.391 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(6), icicles(2), incanters_flow(2), roused_shadowflame, best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(8)
4:52.902 st I flurry Fluffy_Pillow 245025.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(6), icicles(4), incanters_flow(3), roused_shadowflame(2), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(7)
4:54.035 st L glacial_spike Fluffy_Pillow 248190.0/250000: 99% mana bone_chilling(10), cryopathy(6), icicles(5), incanters_flow(5), roused_shadowflame(2), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(6)
4:56.108 st P ice_lance Fluffy_Pillow 247515.0/250000: 99% mana bone_chilling(10), cryopathy(6), incanters_flow(4), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(4)
4:57.241 st Q frostbolt Fluffy_Pillow 250000.0/250000: 100% mana bone_chilling(10), brain_freeze, cryopathy(6), icicles, incanters_flow(3), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered(3)
4:58.750 st I flurry Fluffy_Pillow 245015.0/250000: 98% mana bone_chilling(10), brain_freeze, cryopathy(6), fingers_of_frost, icicles(3), incanters_flow(2), roused_shadowflame(3), best_friends_with_aerwynn, best_friends_with_aerwynn_empowered
4:59.885 st P ice_lance Fluffy_Pillow 248190.0/250000: 99% mana bone_chilling(10), cryopathy(6), fingers_of_frost, icicles(4), incanters_flow, roused_shadowflame(3), best_friends_with_aerwynn

Stats

Level Bonus (70) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength 919 0 1005 919 0
Agility 1421 0 1507 1421 0
Stamina 3848 0 41235 39272 35424
Intellect 2089 0 14848 13972 11218 (1289)
Spirit 0 0 0 0 0
Health 824700 785440 0
Mana 250000 250000 0
Spell Power 14848 13972 0
Crit 30.80% 30.80% 4284
Haste 32.79% 32.79% 3492
Versatility 18.72% 12.01% 2462
Mana Regen 5000 5000 0
Mastery 39.05% 39.05% 5610
Armor 3057 3057 3057
Run Speed 7 0 325

Gear

Source Slot Average Item Level: 479.00
Local Head Wayward Chronomancer's Chronocap
ilevel: 483, stats: { 375 Armor, +887 Int, +3700 Sta, +314 Haste, +697 Mastery }, gems: { +70 Mastery, +33 Vers }, enchant: incandescent_essence
Local Neck Elemental Lariat
ilevel: 476, stats: { +1910 Sta, +841 Mastery, +841 Haste }, gems: { +70 Crit, +33 Mastery, +70 Mastery, +33 Crit, +70 Mastery, +33 Haste }
item effects: { equip: Elemental Lariat }
Local Shoulders Wayward Chronomancer's Metronomes
ilevel: 480, stats: { 336 Armor, +647 Int, +2673 Sta, +228 Vers, +522 Mastery }
Local Shirt Precious' Ribbon
ilevel: 1
item effects: { equip: }
Local Chest Wayward Chronomancer's Patchwork
ilevel: 476, stats: { 475 Armor, +831 Int, +3396 Sta, +671 Crit, +313 Mastery }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Blooming Redeemer's Sash
ilevel: 480, stats: { 275 Armor, +647 Int, +2673 Sta, +533 Haste, +216 Mastery }, gems: { +88 Crit }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Wayward Chronomancer's Pantaloons
ilevel: 483, stats: { 437 Armor, +887 Int, +3700 Sta, +354 Haste, +657 Vers }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Lifewoven Slippers
ilevel: 483, stats: { 312 Armor, +666 Int, +2775 Sta, +222 Haste, +536 Mastery }, enchant: { +131 Sta (watchers_loam_3) }
Local Wrists Vibrant Wildercloth Wristwraps
ilevel: 476, stats: { 237 Armor, +468 Int, +1910 Sta, +277 Crit, +277 Haste }, gems: { +70 Mastery, +33 Crit }, enchant: { +200 RunSpeed (devotion_of_speed_3) }
item effects: { equip: Roiling Shadowflame }
Local Hands Latosius's Blasting Gloves
ilevel: 476, stats: { 267 Armor, +624 Int, +2547 Sta, +227 Crit, +511 Mastery }
Local Finger1 Signet of Titanic Insight
ilevel: 476, stats: { +1910 Sta, +841 Crit, +841 Mastery }, gems: { +70 Mastery, +33 Vers }, enchant: { +82 Mastery (devotion_of_mastery_3) }
item effects: { equip: Griftah's All-Purpose Embellishing Powder }
Local Finger2 Signet of the Last Elder
ilevel: 483, stats: { +2081 Sta, +279 Crit, +1463 Vers }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Mastery (devotion_of_mastery_3) }
Local Trinket1 Augury of the Primal Flame
ilevel: 476, stats: { +703 Crit }
item effects: { equip: Augury of the Primal Flame }
Local Trinket2 Pip's Emerald Friendship Badge
ilevel: 476, stats: { +790 StrAgiInt, +316 Avoidance }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Back Mantle of Blazing Sacrifice
ilevel: 483, stats: { 343 Armor, +2081 Sta, +162 Crit, +406 Mastery, +499 StrAgiInt }, enchant: { +125 RunSpeed (homebound_speed_3) }
Local Main Hand Cerith Spire Staff
ilevel: 483, weapon: { 1022 - 1384, 3.6 }, stats: { +887 Int, +3058 Int, +3700 Sta, +506 Crit, +505 Haste }, enchant: sophic_devotion_3, temporary_enchant: Buzzing Rune
Local Tabard Argent Crusader's Tabard
ilevel: 1
item effects: { use: }

Talents

Talent Tables

RowMage Talents [32]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

mage="Rakshasâ"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/rakshas%C3%A2"
spec=frost
level=70
race=human
role=spell
position=back
talents=BAEAAAAAAAAAAAAAAAAAAAAAAQEUSDJSkigcgkIRERSAAAIlEJhEJJhkkkkkEAAAAAAAAAICA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
actions.precombat+=/snapshot_stats
actions.precombat+=/blizzard,if=active_enemies>=2&talent.ice_caller|active_enemies>=3
actions.precombat+=/frostbolt,if=active_enemies<=2

# Executed every time the actor is available.
actions=counterspell
actions+=/call_action_list,name=cds
actions+=/run_action_list,name=aoe,if=active_enemies>=7&!set_bonus.tier30_2pc|active_enemies>=3&talent.ice_caller
actions+=/run_action_list,name=cleave,if=active_enemies=2
actions+=/run_action_list,name=st

actions.aoe=cone_of_cold,if=talent.coldest_snap&(prev_gcd.1.comet_storm|prev_gcd.1.frozen_orb&!talent.comet_storm)
actions.aoe+=/frozen_orb,if=!prev_gcd.1.glacial_spike|!freezable
actions.aoe+=/blizzard,if=!prev_gcd.1.glacial_spike|!freezable
actions.aoe+=/comet_storm,if=!prev_gcd.1.glacial_spike&(!talent.coldest_snap|cooldown.cone_of_cold.ready&cooldown.frozen_orb.remains>25|cooldown.cone_of_cold.remains>20)
actions.aoe+=/freeze,if=freezable&debuff.frozen.down&(!talent.glacial_spike&!talent.snowstorm|prev_gcd.1.glacial_spike|cooldown.cone_of_cold.ready&buff.snowstorm.stack=buff.snowstorm.max_stack)
actions.aoe+=/ice_nova,if=freezable&!prev_off_gcd.freeze&(prev_gcd.1.glacial_spike|cooldown.cone_of_cold.ready&buff.snowstorm.stack=buff.snowstorm.max_stack&gcd.max<1)
actions.aoe+=/frost_nova,if=freezable&!prev_off_gcd.freeze&(prev_gcd.1.glacial_spike&!remaining_winters_chill|cooldown.cone_of_cold.ready&buff.snowstorm.stack=buff.snowstorm.max_stack&gcd.max<1)
actions.aoe+=/cone_of_cold,if=buff.snowstorm.stack=buff.snowstorm.max_stack
actions.aoe+=/shifting_power
actions.aoe+=/glacial_spike,if=buff.icicles.react=5&cooldown.blizzard.remains>gcd.max
actions.aoe+=/flurry,if=!freezable&cooldown_react&!debuff.winters_chill.remains&(prev_gcd.1.glacial_spike|charges_fractional>1.8)
actions.aoe+=/flurry,if=cooldown_react&!debuff.winters_chill.remains&(buff.brain_freeze.react|!buff.fingers_of_frost.react)
actions.aoe+=/ice_lance,if=buff.fingers_of_frost.react|debuff.frozen.remains>travel_time|remaining_winters_chill
actions.aoe+=/ice_nova,if=active_enemies>=4&(!talent.snowstorm&!talent.glacial_spike|!freezable)
actions.aoe+=/dragons_breath,if=active_enemies>=7
actions.aoe+=/arcane_explosion,if=mana.pct>30&active_enemies>=7
actions.aoe+=/frostbolt
actions.aoe+=/call_action_list,name=movement

actions.cds=time_warp,if=buff.exhaustion.up&talent.temporal_warp&buff.bloodlust.down&(prev_off_gcd.icy_veins|(buff.icy_veins.up&fight_remains<=110|buff.icy_veins.up&fight_remains>=280)|fight_remains<40)
actions.cds+=/use_item,name=spoils_of_neltharus,if=buff.spoils_of_neltharus_mastery.up|buff.spoils_of_neltharus_haste.up&buff.bloodlust.down&buff.temporal_warp.down&time>0|buff.spoils_of_neltharus_vers.up&(buff.bloodlust.up|buff.temporal_warp.up)
actions.cds+=/potion,if=prev_off_gcd.icy_veins|fight_remains<60
actions.cds+=/use_item,name=dreambinder_loom_of_the_great_cycle,if=(equipped.nymues_unraveling_spindle&prev_gcd.1.nymues_unraveling_spindle)|fight_remains>2
actions.cds+=/use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=(gcd.remains>gcd.max-0.1|fight_remains<5)&time>5
actions.cds+=/use_item,name=balefire_branch,if=(!talent.ray_of_frost&active_enemies<=2&buff.icy_veins.up&prev_gcd.1.glacial_spike|remaining_winters_chill=1&cooldown.ray_of_frost.up&time>1&active_enemies<=2|cooldown.cone_of_cold.up&prev_gcd.1.comet_storm&active_enemies>=3)|fight_remains<20
actions.cds+=/flurry,if=time=0&active_enemies<=2
actions.cds+=/icy_veins
actions.cds+=/use_items,if=!equipped.balefire_branch|time>5
actions.cds+=/invoke_external_buff,name=power_infusion,if=buff.power_infusion.down
actions.cds+=/invoke_external_buff,name=blessing_of_summer,if=buff.blessing_of_summer.down
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/lights_judgment
actions.cds+=/fireblood
actions.cds+=/ancestral_call

actions.cleave=comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
actions.cleave+=/flurry,target_if=min:debuff.winters_chill.stack,if=cooldown_react&((prev_gcd.1.frostbolt&buff.icicles.react>=3)|prev_gcd.1.glacial_spike|(buff.icicles.react>=3&buff.icicles.react<5&charges_fractional=2))
actions.cleave+=/ice_lance,target_if=max:debuff.winters_chill.stack,if=talent.glacial_spike&debuff.winters_chill.down&buff.icicles.react=4&buff.fingers_of_frost.react
actions.cleave+=/ray_of_frost,target_if=max:debuff.winters_chill.stack,if=remaining_winters_chill=1
actions.cleave+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
actions.cleave+=/frozen_orb,if=buff.fingers_of_frost.react<2&(!talent.ray_of_frost|cooldown.ray_of_frost.remains)
actions.cleave+=/cone_of_cold,if=talent.coldest_snap&cooldown.comet_storm.remains>10&cooldown.frozen_orb.remains>10&remaining_winters_chill=0&active_enemies>=3
actions.cleave+=/blizzard,if=active_enemies>=2&talent.ice_caller&talent.freezing_rain&(!talent.splintering_cold&!talent.ray_of_frost|buff.freezing_rain.up|active_enemies>=3)
actions.cleave+=/shifting_power,if=cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)|cooldown.icy_veins.remains<20
actions.cleave+=/glacial_spike,if=buff.icicles.react=5
actions.cleave+=/ice_lance,target_if=max:debuff.winters_chill.stack,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
actions.cleave+=/ice_nova,if=active_enemies>=4
actions.cleave+=/frostbolt
actions.cleave+=/call_action_list,name=movement

actions.movement=any_blink,if=movement.distance>10
actions.movement+=/ice_floes,if=buff.ice_floes.down
actions.movement+=/ice_nova
actions.movement+=/arcane_explosion,if=mana.pct>30&active_enemies>=2
actions.movement+=/fire_blast
actions.movement+=/ice_lance

actions.st=comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
actions.st+=/flurry,if=cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&((prev_gcd.1.frostbolt&buff.icicles.react>=3|prev_gcd.1.frostbolt&buff.brain_freeze.react)|prev_gcd.1.glacial_spike|talent.glacial_spike&buff.icicles.react=4&!buff.fingers_of_frost.react)
actions.st+=/ice_lance,if=talent.glacial_spike&debuff.winters_chill.down&buff.icicles.react=4&buff.fingers_of_frost.react
actions.st+=/ray_of_frost,if=remaining_winters_chill=1
actions.st+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
actions.st+=/frozen_orb,if=buff.fingers_of_frost.react<2&(!talent.ray_of_frost|cooldown.ray_of_frost.remains)
actions.st+=/cone_of_cold,if=talent.coldest_snap&cooldown.comet_storm.remains>10&cooldown.frozen_orb.remains>10&remaining_winters_chill=0&active_enemies>=3
actions.st+=/blizzard,if=active_enemies>=2&talent.ice_caller&talent.freezing_rain&(!talent.splintering_cold&!talent.ray_of_frost|buff.freezing_rain.up|active_enemies>=3)
actions.st+=/shifting_power,if=cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)|cooldown.icy_veins.remains<20
actions.st+=/glacial_spike,if=buff.icicles.react=5
actions.st+=/ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
actions.st+=/ice_nova,if=active_enemies>=4
actions.st+=/frostbolt
actions.st+=/call_action_list,name=movement

head=wayward_chronomancers_chronocap,id=207290,bonus_id=6652/7980/9513/9516/9581/1514/8767,gems=70mastery_33vers,enchant=incandescent_essence
neck=elemental_lariat,id=193001,bonus_id=8836/8840/8902/8960/8784/8782/9405/8793/9499/9498,gems=70crit_33mastery_70mastery_33crit_70mastery_33haste,crafted_stats=vers/haste
shoulders=wayward_chronomancers_metronomes,id=207288,bonus_id=6652/9639/9511/9572/1511/8767
back=mantle_of_blazing_sacrifice,id=207161,bonus_id=6652/9508/7980/9581/1514/8767,enchant=homebound_speed_3
chest=wayward_chronomancers_patchwork,id=207293,bonus_id=6652/9639/9515/9567/1507/8767,enchant=waking_stats_3
shirt=precious_ribbon,id=52019
tabard=argent_crusaders_tabard,id=46874
wrists=vibrant_wildercloth_wristwraps,id=193510,bonus_id=8836/8840/8902/9405/9499/8790/9379/8960/9498/9516,gems=70mastery_33crit,enchant=devotion_of_speed_3,crafted_stats=crit/vers
hands=latosiuss_blasting_gloves,id=134431,bonus_id=9639/6652/9506/9144/9567/9849/8767
waist=blooming_redeemers_sash,id=207124,bonus_id=6652/9508/7980/9572/1511/8767/9516,gems=88crit,enchant=shadowed_belt_clasp_3
legs=wayward_chronomancers_pantaloons,id=207289,bonus_id=6652/7980/9512/9581/1514/8767,enchant=frozen_spellthread_3
feet=lifewoven_slippers,id=207123,bonus_id=6652/9508/7980/9581/1514/8767,enchant=watchers_loam_3
finger1=signet_of_titanic_insight,id=192999,bonus_id=8836/8840/8902/8780/9405/8791/9499/9237/9498,gems=70mastery_33vers,enchant=devotion_of_mastery_3,crafted_stats=crit/mastery
finger2=signet_of_the_last_elder,id=207162,bonus_id=6652/9516/7980/9581/1514/8767,gems=70mastery_33haste,enchant=devotion_of_mastery_3
trinket1=augury_of_the_primal_flame,id=208614,bonus_id=6652/7982/9567/1507/8767
trinket2=pips_emerald_friendship_badge,id=207168,bonus_id=40/7979/9567/1507/8767
main_hand=cerith_spire_staff,id=133184,bonus_id=9639/6652/9147/9581/9889/8767,enchant=sophic_devotion_3

# Gear Summary
# gear_ilvl=479.33
# gear_stamina=35424
# gear_intellect=11218
# gear_crit_rating=4200
# gear_haste_rating=3112
# gear_mastery_rating=5500
# gear_versatility_rating=2414
# gear_speed_rating=325
# gear_avoidance_rating=316
# gear_armor=3057
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 48093429
Max Event Queue: 117
Sim Seconds: 3002263
CPU Seconds: 31.7534
Physical Seconds: 29.8566
Speed Up: 94549

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Rakshasâ Rakshasâ annihilating_flame 426564 3057037 10190 11.66 39665 79319 58.3 58.3 32.2% 0.0% 0.0% 0.0% 4.67sec 3057037 300.02sec
Rakshasâ Rakshasâ augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
Rakshasâ Rakshasâ comet_storm 153595 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 28.85sec 0 300.02sec
Rakshasâ Rakshasâ comet_storm_projectile 153596 2774781 9249 15.07 18633 37615 75.4 75.4 95.8% 0.0% 0.0% 0.0% 3.81sec 2774781 300.02sec
Rakshasâ Rakshasâ flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
Rakshasâ Rakshasâ flurry 44614 0 0 0.00 0 0 44.0 0.0 0.0% 0.0% 0.0% 0.0% 6.86sec 0 300.02sec
Rakshasâ Rakshasâ flurry_bolt 228354 3880240 12933 26.31 15807 33557 131.6 131.6 77.1% 0.0% 0.0% 0.0% 2.26sec 3880240 300.02sec
Rakshasâ Rakshasâ flurry_icicle 148022 122682 409 0.75 22992 53244 3.8 3.7 32.2% 0.0% 0.0% 0.0% 61.08sec 122682 300.02sec
Rakshasâ Rakshasâ glacial_assault 379029 598548 1995 6.57 8827 18479 32.9 32.9 97.2% 0.0% 0.0% 0.0% 8.94sec 598548 300.02sec
Rakshasâ Rakshasâ food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
Rakshasâ Rakshasâ frostbolt 116 2685065 8950 9.48 28588 67669 46.6 47.4 71.8% 0.0% 0.0% 0.0% 6.06sec 2685065 300.02sec
Rakshasâ Rakshasâ frostbolt_icicle 148022 84491 282 0.53 22246 51509 2.6 2.6 33.6% 0.0% 0.0% 0.0% 66.91sec 84491 300.02sec
Rakshasâ Rakshasâ frozen_orb 84714 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 52.97sec 0 300.02sec
Rakshasâ Rakshasâ frozen_orb_bolt 84721 1310198 4367 28.02 5435 11739 140.1 140.1 62.1% 0.0% 0.0% 0.0% 1.95sec 1310198 300.02sec
Rakshasâ Rakshasâ glacial_spike 199786 27953434 93173 7.81 320561 764009 39.2 39.1 89.0% 0.0% 0.0% 0.0% 7.55sec 27953434 300.02sec
Rakshasâ Rakshasâ glacial_blast 424120 0 0 0.00 0 0 33.9 0.0 0.0% 0.0% 0.0% 0.0% 8.66sec 0 300.02sec
Rakshasâ Rakshasâ ice_lance 30455 10777910 35924 18.09 56875 121015 90.6 90.4 97.1% 0.0% 0.0% 0.0% 3.30sec 10777910 300.02sec
Rakshasâ Rakshasâ ice_lance_icicle 148022 136006 453 0.83 22484 52200 4.2 4.2 34.1% 0.0% 0.0% 0.0% 51.77sec 136006 300.02sec
Rakshasâ Rakshasâ icy_veins 12472 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 100.34sec 0 300.02sec
Rakshasâ Rakshasâ potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.49sec 0 300.02sec
Rakshasâ Rakshasâ ray_of_frost ticks -205021 7547954 25160 6.04 121522 258223 6.1 30.2 93.9% 0.0% 0.0% 0.0% 52.88sec 7547954 300.02sec
Rakshasâ Rakshasâ roiling_shadowflame 406251 759886 2533 8.52 13509 27003 42.6 42.6 32.1% 0.0% 0.0% 0.0% 6.95sec 759886 300.02sec
Rakshasâ Rakshasâ shifting_power ticks -382440 573506 1912 3.84 14990 33614 4.8 19.2 79.8% 0.0% 0.0% 0.0% 65.83sec 573506 300.02sec
Rakshasâ Rakshasâ time_warp 80353 0 0 0.00 0 0 1.3 0.0 0.0% 0.0% 0.0% 0.0% 259.42sec 0 300.02sec
Rakshasâ Rakshasâ tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.8 0.0 0.0% 0.0% 0.0% 0.0% 30.90sec 0 300.02sec
Rakshasâ Rakshasâ denizen_of_the_flame 426431 660843 2203 3.50 28605 57180 17.5 17.5 32.2% 0.0% 0.0% 0.0% 14.70sec 660843 300.02sec
Rakshasâ Rakshasâ denizen_of_the_flame_final 426486 691704 2306 1.74 60097 120099 8.7 8.7 32.4% 0.0% 0.0% 0.0% 30.87sec 691704 300.02sec
Rakshasâ Rakshasâ_water_elemental water_jet ticks -135029 433960 1447 8.62 7628 15245 9.1 43.1 32.1% 0.0% 0.0% 0.0% 33.43sec 433960 144.98sec
Rakshasâ Rakshasâ_water_elemental waterbolt 31707 1082353 7466 35.95 9431 18848 87.3 86.9 32.2% 0.0% 0.0% 0.0% 3.17sec 1082353 144.98sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
208757.5 0.0 Health 0.00% 0.0 100.0% 100%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
frozen 39.1 0.0 7.5s 7.5s 1.0s 13.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_frozen
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:max
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 18.9s
  • trigger_min/max:3.6s / 18.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 1.0s
  • uptime_min/max:11.97% / 14.19%

Stack Uptimes

  • frozen_1:13.00%
Numbing Blast 19.4 88.9 15.7s 2.7s 9.2s 59.10% 0.00% 88.9 (88.9) 18.8

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_numbing_blast
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 77.3s
  • trigger_min/max:0.0s / 54.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:37.91% / 80.86%

Stack Uptimes

  • numbing_blast_1:59.10%

Spelldata

  • id:417490
  • name:Numbing Blast
  • tooltip:Damage taken from {$@=}auracaster's spells increased by {$s1=6}%
  • description:{$@spelldesc378947=Your Comet Storm now increases the damage enemies take from you by {$417490s1=6}% for {$417490d=6 seconds} and Flurry has a {$s1=25}% chance each hit to call down an icy comet, crashing into your target and nearby enemies for {$379029s1=0} Frost damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Winter's Chill 43.9 87.7 6.9s 2.3s 3.4s 49.87% 0.00% 87.7 (136.9) 3.1

Buff Details

  • buff initial source:Rakshasâ
  • cooldown name:buff_winters_chill
  • max_stacks:2
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 34.1s
  • trigger_min/max:0.2s / 33.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.6s
  • uptime_min/max:38.59% / 58.58%

Stack Uptimes

  • winters_chill_1:21.28%
  • winters_chill_2:28.59%

Spelldata

  • id:228358
  • name:Winter's Chill
  • tooltip:Taking damage from the Mage's spells as if frozen.
  • description:{$@spelldesc44614=Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.}
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.02
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 217213.89
Minimum 193898.91
Maximum 239676.01
Spread ( max - min ) 45777.10
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 6558.0103
5th Percentile 206430.81
95th Percentile 228019.65
( 95th Percentile - 5th Percentile ) 21588.83
Mean Distribution
Standard Deviation 65.5834
95.00% Confidence Interval ( 217085.35 - 217342.43 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3502
0.1 Scale Factor Error with Delta=300 367137
0.05 Scale Factor Error with Delta=300 1468547
0.01 Scale Factor Error with Delta=300 36713675
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1317
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 76679351 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.