SimulationCraft 1115-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.1.5.60568 Live (hotfix 2025-05-09/60568, git build 1de8cc0f9d)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Rogue

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-05-06 Grand Melee Blade Flurry Bonus
Grand Melee (effect#2) base_value 20.00 10.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Araylini 10.85 -0.20 7.39 9.65 6.90 7.21 59.26 wowhead

Araylini : 666,633 dps, 1,258,448 dtps, 199,909 hps (77,970 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
666,633.1666,633.1393.7 / 0.059%78,681.3 / 11.8%-1.0
HPS HPS(e) HPS Error HPS Range HPR
121,939.0121,939.0449.3 / 0.368%90,323.7 / 74.1%-1.0
APS APS Error APS Range APR
77,970.2236.5 / 0.303%9,356.0 / 12.0%-1.0
DTPS DTPS Error DTPS Range
1,258,447.9988.77 / 0.08%196,909 / 15.6%
Resource Out In Waiting APM Active
Mana0.00.00.00%74.2100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/araylini
TalentCIEAN/WrsXv0CO5mzTm8Icl8KsNzMDz2YZMjZM2mZmZmxYYAAAGAAAAAAASmZWMMDGzY2aDAGDYAMYbAAAmZabWmtZACsZgBgZGGGD
Scale Factors for Araylini Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 59.26 10.85 9.65 7.39 7.21 6.90 -0.20
Normalized 5.46 1.00 0.89 0.68 0.66 0.64 -0.02
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.27 0.25 0.24 0.25 0.25 0.25 0.24
Ranking
  • Wdps > Str > Haste > Crit ~= Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=10.85, Stamina=-0.20, CritRating=7.39, HasteRating=9.65, MasteryRating=6.90, Versatility=7.21, Dps=59.26 )

Scale Factors for other metrics

Scale Factors for Araylini Priority Target Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 59.26 10.85 9.65 7.39 7.21 6.90 -0.20
Normalized 5.46 1.00 0.89 0.68 0.66 0.64 -0.02
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.27 0.25 0.24 0.25 0.25 0.25 0.24
Ranking
  • Wdps > Str > Haste > Crit ~= Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=10.85, Stamina=-0.20, CritRating=7.39, HasteRating=9.65, MasteryRating=6.90, Versatility=7.21, Dps=59.26 )
Scale Factors for Araylini Damage Per Second (Effective)
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 59.26 10.85 9.65 7.39 7.21 6.90 -0.20
Normalized 5.46 1.00 0.89 0.68 0.66 0.64 -0.02
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Haste > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=10.85, Stamina=-0.20, CritRating=7.39, HasteRating=9.65, MasteryRating=6.90, Versatility=7.21, Dps=59.26 )
Scale Factors for Araylini Healing Per Second
Wdps Haste Str Vers Mastery Crit Sta
Scale Factors 5.22 1.39 0.87 0.53 0.44 0.34 0.18
Normalized 6.00 1.60 1.00 0.61 0.51 0.39 0.21
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.31 0.28 0.28 0.28 0.28 0.28 0.28
Ranking
  • Wdps > Haste > Str > Vers ~= Mastery ~= Crit ~= Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=0.87, Stamina=0.18, CritRating=0.34, HasteRating=1.39, MasteryRating=0.44, Versatility=0.53, Dps=5.22 )
Scale Factors for Araylini Healing Per Second (Effective)
Wdps Haste Str Vers Mastery Crit Sta
Scale Factors 5.22 1.39 0.87 0.53 0.44 0.34 0.18
Normalized 6.00 1.60 1.00 0.61 0.51 0.39 0.21
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Vers > Mastery > Crit > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=0.87, Stamina=0.18, CritRating=0.34, HasteRating=1.39, MasteryRating=0.44, Versatility=0.53, Dps=5.22 )
Scale Factors for Araylini Absorb Per Second
Wdps Vers Str Haste Mastery Crit Sta
Scale Factors 3.12 0.73 0.56 0.51 0.34 0.26 0.21
Normalized 5.56 1.31 1.00 0.91 0.61 0.47 0.38
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.15 0.14 0.15 0.15 0.14 0.14 0.14
Ranking
  • Wdps > Vers > Str ~= Haste > Mastery ~= Crit ~= Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=0.56, Stamina=0.21, CritRating=0.26, HasteRating=0.51, MasteryRating=0.34, Versatility=0.73, Dps=3.12 )
Scale Factors for Healing + Absorb per second
Wdps Haste Str Vers Mastery Crit Sta
Scale Factors 8.34 1.90 1.43 1.27 0.78 0.60 0.40
Normalized 5.83 1.33 1.00 0.89 0.55 0.42 0.28
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.34 0.32 0.32 0.31 0.31 0.31 0.31
Ranking
  • Wdps > Haste > Str ~= Vers > Mastery ~= Crit ~= Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=1.43, Stamina=0.40, CritRating=0.60, HasteRating=1.90, MasteryRating=0.78, Versatility=1.27, Dps=8.34 )
Scale Factors for Araylini Damage Taken Per Second
Vers Mastery Crit Str Wdps Haste Sta
Scale Factors -10.64 -8.79 -8.74 -5.91 -3.67 -0.95 -0.84
Normalized 1.80 1.49 1.48 1.00 0.62 0.16 0.14
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.60 0.60 0.61 0.60 0.61 0.60 0.61
Ranking
  • Vers > Mastery ~= Crit > Str > Wdps > Haste ~= Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=5.91, Stamina=0.84, CritRating=8.74, HasteRating=0.95, MasteryRating=8.79, Versatility=10.64, Dps=3.67 )
Scale Factors for Araylini Damage Taken
Vers Mastery Crit Str Wdps Haste Sta
Scale Factors -3177.87 -2630.38 -2592.34 -1729.76 -1096.29 -272.99 -235.39
Normalized 1.84 1.52 1.50 1.00 0.63 0.16 0.14
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Mastery > Crit > Str > Wdps > Haste > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=1729.76, Stamina=235.39, CritRating=2592.34, HasteRating=272.99, MasteryRating=2630.38, Versatility=3177.87, Dps=1096.29 )
Scale Factors for Araylini Healing Taken Per Second
Wdps Haste Str Vers Mastery Crit Sta
Scale Factors 5.21 1.39 0.87 0.52 0.42 0.31 0.17
Normalized 6.03 1.60 1.00 0.60 0.48 0.36 0.20
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Vers > Mastery > Crit > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=0.87, Stamina=0.17, CritRating=0.31, HasteRating=1.39, MasteryRating=0.42, Versatility=0.52, Dps=5.21 )
Scale Factors for Araylini Fight Length
Str Sta Haste Vers Crit Wdps Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 -0.00 -0.00
Normalized 1.00 0.66 0.66 0.34 0.32 -0.00 -0.33
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Sta > Haste > Vers > Crit > Wdps > Mastery
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=0.00, Stamina=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 59.26 10.85 9.65 7.39 7.21 6.90 -0.20
Normalized 5.46 1.00 0.89 0.68 0.66 0.64 -0.02
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.27 0.25 0.24 0.25 0.25 0.25 0.24
Ranking
  • Wdps > Str > Haste > Crit ~= Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Araylini-Protection": Class=Paladin, Spec=Protection, Strength=10.85, Stamina=-0.20, CritRating=7.39, HasteRating=9.65, MasteryRating=6.90, Versatility=7.21, Dps=59.26 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Araylini666,633
Avenger's Shield 30,216 (33,437)4.5% (5.0%)28.410.51s352,811302,928Direct28.4 (56.8)241,768510,139318,95528.8% (28.7%)

Stats Details: Avengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.4128.400.000.000.001.16470.00009,058,329.469,058,329.460.00%302,927.69302,927.69
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.24%20.23831241,768.22202,291306,297241,662.12223,641261,3284,891,4554,891,4550.00%
crit28.76%8.17020510,138.79405,899612,595511,051.820612,5954,166,8744,166,8740.00%

Action Details: Avengers Shield

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=true}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Action Priority List

    standard
    [P]:28.41
  • if_expr:talent.refining_fire.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Tyr's Enforcer (avengers_shield) 3,2210.5%28.410.51s33,9980Direct28.425,79154,45433,99728.6%

Stats Details: Tyrs Enforceravengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.4028.400.000.000.000.00000.0000965,547.87965,547.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.37%20.2783325,791.4221,59032,69025,779.7223,81227,926522,754522,7540.00%
crit28.63%8.1301954,453.8943,18065,38054,566.46065,194442,794442,7940.00%

Action Details: Tyrs Enforceravengers Shield

  • id:378286
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378286
  • name:Tyr's Enforcer
  • school:holy
  • tooltip:
  • description:{$@spelldesc378285=Your Avenger's Shield is imbued with holy fire, causing it to deal {$=}<dmg> Holy damage to all enemies within {$378286=}A1 yards of each target hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Blessed Hammer 0 (15,241)0.0% (2.3%)68.04.28s67,15057,045

Stats Details: Blessed Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.030.000.000.000.001.17720.00000.000.000.00%57,044.6757,044.67

Action Details: Blessed Hammer

  • id:204019
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:5.000
  • cooldown hasted:true
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Spelldata

  • id:204019
  • name:Blessed Hammer
  • school:holy
  • tooltip:
  • description:Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [R]:63.27
  • if_expr:(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
    standard
    [T]:4.77

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Paladin1370265SET1.000
    Blessed Hammer (_tick) 15,2412.3%0.00.00s00Periodic135.625,81354,48933,68327.4%0.0%

Stats Details: Blessed Hammer Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00135.630.000.00000.00004,568,479.124,568,479.120.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.56%98.416213825,812.5421,81233,02725,807.5624,42827,3352,540,2222,540,2220.00%
crit27.44%37.22146254,489.0243,62566,05454,544.0750,77059,8532,028,2572,028,2570.00%

Action Details: Blessed Hammer Tick

  • id:204301
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:9.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:204301
  • name:Blessed Hammer
  • school:holy
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Consecration 0 (5,504)0.0% (0.8%)7.533.09s221,291207,171

Stats Details: Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.450.000.000.000.001.06820.00000.000.000.00%207,170.84207,170.84

Action Details: Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Action Priority List

    standard
    [S]:6.33
  • if_expr:!consecration.up
    standard
    [W]:0.13

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Consecration (_tick) 5,5040.8%0.00.00s00Periodic132.79,51820,07312,43427.6%0.0%

Stats Details: Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00132.650.000.00000.00001,649,494.241,649,494.240.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.37%96.00171719,518.438,05412,1959,529.928,90410,794913,830913,8300.00%
crit27.63%36.6577720,073.0316,10824,38920,109.3918,22722,806735,665735,6650.00%

Action Details: Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Divine Toll 0 (8,216)0.0% (1.2%)7.045.71s353,215305,014

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.970.000.000.000.001.15810.00000.000.000.00%305,013.78305,013.78

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    standard
    [O]:6.97
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Global CooldownPaladin1370268SET1.000
    Avenger's Shield (_dt) 7,423 (8,216)1.1% (1.2%)7.045.71s353,2150Direct7.0 (13.9)241,823508,653319,27029.0% (28.9%)

Stats Details: Avengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.976.970.000.000.000.00000.00002,224,293.392,224,293.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.98%4.9408241,823.08208,535306,297241,304.590295,5631,195,8191,195,8190.00%
crit29.02%2.0207508,653.25419,552612,595463,897.660612,5951,028,4751,028,4750.00%

Action Details: Avengers Shield Dt

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=true}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
        Tyr's Enforcer (avengers_shield_dt) 7930.1%7.045.71s34,0860Direct7.025,83054,56334,08528.7%

Stats Details: Tyrs Enforceravengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.976.970.000.000.000.00000.0000237,472.83237,472.830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.27%4.970825,829.9422,38932,69025,761.76031,931128,252128,2520.00%
crit28.73%2.000854,563.2144,92965,38049,616.16065,380109,221109,2210.00%

Action Details: Tyrs Enforceravengers Shield Dt

  • id:378286
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378286
  • name:Tyr's Enforcer
  • school:holy
  • tooltip:
  • description:{$@spelldesc378285=Your Avenger's Shield is imbued with holy fire, causing it to deal {$=}<dmg> Holy damage to all enemies within {$378286=}A1 yards of each target hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Empyrean Hammer 168,62425.3%393.80.77s128,3860Direct393.8 (393.8)96,747204,367128,38429.4% (29.4%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage393.79393.790.000.000.000.00000.000050,557,248.5050,557,248.500.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.60%278.0216438096,747.0668,956156,32696,752.1391,243102,29626,898,17126,898,1710.00%
crit29.40%115.7757177204,366.63140,009312,653204,555.12189,070227,44123,659,07723,659,0770.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Eye for an Eye 3,1150.5%11.129.87s83,5180Direct11.160,590127,37183,51734.3%

Stats Details: Eye For An Eye

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.1111.110.000.000.000.00000.0000928,008.70928,008.700.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit65.67%7.3011360,589.7048,48671,84760,501.5751,14369,811442,119442,1190.00%
crit34.33%3.81010127,371.1998,411143,694126,493.790143,694485,890485,8900.00%

Action Details: Eye For An Eye

  • id:469311
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.54
  • base_multiplier:1.00

Spelldata

  • id:469311
  • name:Eye for an Eye
  • school:holy
  • tooltip:
  • description:{$@spelldesc469309=Melee and ranged attackers receive {$469311s1=0} Holy damage each time they strike you during {$?=}c2[Ardent Defender][Divine Protection] and Divine Shield.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Eye of Tyr 14,2562.1%7.741.76s557,323464,232Direct7.7418,339874,931557,30130.4%

Stats Details: Eye Of Tyr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.677.670.000.000.001.20060.00004,274,650.394,274,650.390.00%464,232.23464,232.23
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.56%5.3409418,339.23365,145498,870417,428.560493,3922,232,0402,232,0400.00%
crit30.44%2.3308874,930.93730,291997,741823,697.790997,7412,042,6112,042,6110.00%

Action Details: Eye Of Tyr

  • id:387174
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:40.199
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:387174
  • name:Eye of Tyr
  • school:holy
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.

Action Priority List

    standard
    [K]:4.87
  • if_expr:(hpg_to_2dawn=5|!talent.of_dusk_and_dawn.enabled)&talent.lights_guidance.enabled
    standard
    [L]:2.80
  • if_expr:(hpg_to_2dawn=1|buff.blessing_of_dawn.stack>0)&talent.lights_guidance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Garbocalypse 21,6683.3%2.8120.63s2,327,6510Direct2.81,743,6613,531,0412,327,64032.7%

Stats Details: Garbocalypse

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.792.790.000.000.000.00000.00006,498,985.649,284,255.9230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.33%1.88031,743,660.501,672,1471,928,0531,670,838.2301,928,0533,277,8994,682,70828.79%
crit32.67%0.91033,531,040.543,344,2933,856,1052,388,034.5403,856,1053,221,0874,601,54820.25%

Action Details: Garbocalypse

  • id:1219299
  • school:physical
  • range:50000.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1997479.68
  • base_dd_max:1997479.68
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:1219299
  • name:Garbocalypse
  • school:physical
  • tooltip:
  • description:
Hammer of Light 79,39011.9%13.522.95s1,760,1341,440,932Direct13.51,345,3342,784,4141,760,01528.8%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.5413.540.000.000.001.22160.000023,833,010.9323,833,010.930.00%1,440,931.741,440,931.74
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.18%9.642171,345,333.68822,6522,509,6591,344,402.14973,5041,681,08512,967,28712,967,2870.00%
crit28.82%3.900122,784,413.751,645,3044,893,9912,762,234.4204,289,70210,865,72310,865,7230.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$s2=0} Holy damage and {$429826s1=0} Holy damage up to {$s1=4} nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    standard
    [J]:13.54
  • if_expr:buff.hammer_of_light_free.remains<2|buff.shake_the_heavens.remains<1|!buff.shake_the_heavens.up|cooldown.eye_of_tyr.remains<1.5|fight_remains<2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Global CooldownPaladin1370268SET1.000
(hammer_of_light_) Consecration 0 (10,244)0.0% (1.5%)13.522.96s227,3940

Stats Details: Hammer Of Light Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.520.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Hammer Of Light Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    (hammer_of_light_) Consecration 10,2441.5%0.00.00s00Periodic245.69,56620,11612,51928.0%0.0%

Stats Details: Hammer Of Light Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00245.560.000.00000.00003,074,270.543,074,270.540.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.01%176.83982419,565.898,05412,1959,565.249,08310,0811,691,5391,691,5390.00%
crit27.99%68.733011520,116.4716,10824,38920,130.4618,96021,5891,382,7311,382,7310.00%

Action Details: Hammer Of Light Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hammer of Wrath 47,8147.2%29.410.33s487,583426,080Direct29.3352,780727,159487,93236.1%

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage29.3729.350.000.000.001.14440.000014,317,994.9014,317,994.900.00%426,080.08426,080.08
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.90%18.75732352,779.77274,526415,670352,686.20322,367380,3356,615,1686,615,1680.00%
crit36.10%10.59121727,158.71550,837831,340727,946.11642,771804,4137,702,8277,702,8270.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [N]:29.36

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountProtection Paladin13702818PCT68.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Holy Shield 3,2960.5%40.97.23s24,1410Direct40.918,11738,31924,15229.9%

Stats Details: Holy Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.9340.910.000.000.000.00000.0000988,104.42988,104.420.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.13%28.69115618,116.7214,99122,69918,105.0716,37319,809519,842519,8420.00%
crit29.87%12.2212838,318.6329,98245,39738,352.1332,16444,152468,262468,2620.00%

Action Details: Holy Shield

  • id:157122
  • school:holy
  • range:100.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Your block chance is increased by {$s1=20}%, you are able to block spells, and your successful blocks deal {$157122s1=0} Holy damage to your attacker.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Judgment 111,49216.7%88.43.41s378,129326,257Direct88.3285,772603,065378,27529.2%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage88.3788.330.000.000.001.15900.000033,413,593.9933,413,593.990.00%326,256.84326,256.84
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.84%62.573789285,771.90238,067360,469285,728.41269,037302,03617,881,41917,881,4190.00%
crit29.16%25.76747603,064.96476,135720,938603,841.60540,575663,23915,532,17515,532,1750.00%

Action Details: Judgment

  • id:275779
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:0.450
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.237500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.32
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275779
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability][].{$?a315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    standard
    [I]:23.09
  • if_expr:charges>=2|full_recharge_time<=gcd.max
  • target_if_expr:debuff.judgment.remains
    standard
    [Q]:65.28
  • target_if_expr:debuff.judgment.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Modify Recharge Time% (Category)Protection Paladin1370283SET-0.550
Hasted Global CooldownProtection Paladin1370285SET1.000
Hasted Cooldown Duration (Category)Protection Paladin1370286SET1.000
Spell Direct AmountProtection Paladin13702811PCT-14.0%
Light's Judgment 0 (4,412)0.0% (0.7%)2.5150.40s530,415739,028

Stats Details: Lights Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.510.000.000.000.000.71790.00000.000.000.00%739,028.02739,028.02

Action Details: Lights Judgment

  • id:255647
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:255647
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing {$=}<damage> Holy damage to enemies within {$=}A1 yards after {$s1=3} sec. Damage reduced beyond {$s2=8} targets.

Action Priority List

    cooldowns
    [E]:1.51
  • if_expr:spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
    Light's Judgment (_damage) 4,4120.7%2.5150.39s535,6940Direct2.5411,225831,424535,69329.6%

Stats Details: Lights Judgment Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.482.480.000.000.000.00000.00001,329,511.411,329,511.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.38%1.7503411,225.18369,744442,005386,584.470442,005718,269718,2690.00%
crit29.62%0.7403831,424.28753,175884,010491,704.580884,010611,242611,2420.00%

Action Details: Lights Judgment Damage

  • id:256893
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:4.200000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:256893
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing {$=}<damage> Holy damage to enemies within {$=}A1 yards.
melee 25,7713.9%181.01.98s42,69121,472Direct181.032,30268,11242,69029.0%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage180.98180.980.000.000.001.98820.00007,726,273.8611,037,523.0530.00%21,472.3121,472.31
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.99%128.488618632,301.5926,95440,81132,299.0830,85133,9544,150,0725,928,66830.00%
crit29.01%52.50248968,111.6553,90781,62268,177.5863,10073,4113,576,2025,108,85530.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Ratfang Toxin 20,8903.1%3.694.70s1,715,7430Periodic26.5175,159339,687235,70736.8%6.0%

Stats Details: Ratfang Toxin

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.0026.5526.550.000.00000.68226,257,081.006,257,081.000.00%345,485.120.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit63.19%16.78528175,159.171,813220,902174,826.42113,508208,0522,938,0962,938,0960.00%
crit36.81%9.77121339,686.628,495441,804339,625.8930,525441,8043,318,9853,318,9850.00%

Action Details: Ratfang Toxin

  • id:1216606
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:169892.37
  • base_td_mult:0.66
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:1216606
  • name:Ratfang Toxin
  • school:nature
  • tooltip:Inflicting {$=}w1 damage every {$t1=1} sec.
  • description:{$@spelldesc1216605=Release all toxin stacks to deal {$=}{{$1216603s2=259635}*{$=}<rolemult>} Nature damage, plus {$=}{{$1216603s3=29673}*{$=}<rolemult>} per stack over {$1216606d=5 seconds}1.}
Refining Fire 18,6282.8%35.48.44s157,7920Periodic222.218,98540,35725,12128.7%53.8%

Stats Details: Refining Fire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.370.00222.15222.158.650.00000.72665,580,633.385,580,633.380.00%34,574.270.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.29%158.379623018,985.212145,02119,009.6216,81021,5603,006,6673,006,6670.00%
crit28.71%63.782910640,356.794190,04140,429.8833,67349,6002,573,9662,573,9660.00%

Action Details: Refining Fire

  • id:469882
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.115500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.54
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:469882
  • name:Refining Fire
  • school:holyfire
  • tooltip:Suffering {$=}w1 Radiant damage every $t sec.
  • description:Enemies struck by Avenger's Shield burn with holy fire, suffering {$=}o1 Radiant damage over {$d=5 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Shield of the Righteous 56,7168.5%96.53.11s176,1800Direct96.5132,346272,818176,18731.2%

Stats Details: Shield Of The Righteous

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage96.4796.470.000.000.000.00000.000016,996,732.6816,996,732.680.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.79%66.373898132,345.5968,458239,374132,403.38121,362145,1758,783,3548,783,3540.00%
crit31.21%30.111258272,818.23136,915478,752273,203.06233,112310,5328,213,3798,213,3790.00%

Action Details: Shield Of The Righteous

  • id:53600
  • school:holy
  • range:5.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][]

Action Priority List

    standard
    [M]:96.47
  • if_expr:!set_bonus.thewarwithin_season_2_4pc&(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT54.0%
Spell Periodic AmountProtection Paladin1370282PCT54.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hasted Global CooldownProtection Paladin1370285SET1.000
Undersea Overseer's Citrine 17,9202.7%28.810.16s186,7190Direct28.8144,534290,309186,72028.9%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.7828.780.000.000.000.00000.00005,373,491.055,373,491.050.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.06%20.45841144,534.00140,059161,494144,517.39140,090152,4292,955,8492,955,8490.00%
crit28.94%8.33021290,309.03280,119322,988290,409.540315,6302,417,6422,417,6420.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180895.04
  • base_dd_max:180895.04
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Araylini 199909
blessed_hammer_absorb 8,5104.3%0.00.00s00Direct106.324,002024,0020.0%

Stats Details: Blessed Hammer Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.00106.320.000.000.000.00000.00002,551,854.170.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%106.327514024,002.2822,29025,93724,002.6623,58425,2022,551,85400.00%
bulwark_of_order_absorb 22,52011.2%0.00.00s00Direct34.6195,3710195,3710.0%

Stats Details: Bulwark Of Order Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0034.550.000.000.000.00000.00006,750,577.500.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%34.552447195,370.70121,375735,114195,548.66153,094254,6006,750,57700.00%
sacrosanct_crusade_absorb 47,05623.5%0.00.00s00Direct15.3923,1880923,1880.0%

Stats Details: Sacrosanct Crusade Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0015.260.000.000.000.00000.000014,091,904.520.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%15.26925923,188.26213,208,206938,004.69664,4631,335,57914,091,90500.00%
Sacrosanct Crusade (_heal) 67,48533.8%13.522.95s1,497,2130Direct13.51,497,21701,497,2170.0%

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal13.5413.540.000.000.000.00000.000020,272,938.3221,798,059.327.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%13.548171,497,216.8501,616,6291,495,177.141,414,5501,521,53320,272,93821,798,0597.12%

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1616628.60
  • base_dd_max:1616628.60
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=true}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=true}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=true}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=true}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Word of Glory 54,45427.3%4.535.11s3,612,3112,917,393Direct4.53,004,4146,043,1533,612,06820.0%

Stats Details: Word Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal4.544.540.000.000.001.23830.000016,395,751.0016,395,751.000.00%2,917,393.422,917,393.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.99%3.630103,004,413.972,046,6284,448,1482,951,544.0604,448,14810,907,50310,907,5030.00%
crit20.01%0.91056,043,152.725,164,1138,896,2963,634,485.8708,896,2965,488,2485,488,2480.00%

Action Details: Word Of Glory

  • id:85673
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:false

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.465000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10
  • base_multiplier:1.00

Spelldata

  • id:85673
  • name:Word of Glory
  • school:holy
  • tooltip:
  • description:Calls down the Light to heal a friendly target for $130551s1{$?a378405=false}[ and an additional {$378405s1=20}% over {$378412d=10 seconds}][].{$?a379043=false}[ Your block chance is increased by {$379043s1=5}% for {$379041d=6 seconds}.][]{$?a315921=true}&!a315924[ |cFFFFFFFFProtection:|r If cast on yourself, healing increased by up to {$315921s1=300}% based on your missing health.][]{$?a315924=false}[ |cFFFFFFFFProtection:|r Healing increased by up to {$315921s1=300}% based on your missing health, or up to {$315924s1=100}% if cast on another target.][]

Action Priority List

    standard
    [U]:4.53
  • if_expr:buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))
    standard
    [V]:0.01
  • if_expr:buff.shining_light_free.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin13702817PCT110.0%
Simple Action Stats Execute Interval
Araylini
Ardent Defender 6.849.24s

Stats Details: Ardent Defender

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.810.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Ardent Defender

  • id:31850
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:84.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31850
  • name:Ardent Defender
  • school:physical
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.

Action Priority List

    defensives
    [H]:6.81
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 4.382.59s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:454351
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:454351
  • name:Avenging Wrath
  • school:holy
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=false}&s384376[increasing your damage, healing and critical strike chance by {$s2=20}% for {$d=8 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=20}% for {$d=8 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=20}% for {$d=8 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=8 seconds}.]

Action Priority List

    cooldowns
    [F]:4.29
Devotion Aura 1.00.00s

Stats Details: Devotion Aura

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Devotion Aura

  • id:465
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:465
  • name:Devotion Aura
  • school:holy
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
garbagemancers_last_resort 2.8120.63s

Stats Details: Garbagemancers Last Resort

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.820.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Garbagemancers Last Resort

  • id:1219294
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1219294
  • name:Garbagemancer's Last Resort
  • school:physical
  • tooltip:
  • description:Fashion nearby garbage into a sphere and launch it into the sky. After {$1219296s2=3} sec of gathering momentum the sphere crashes into the targeted location dealing {$1219296s1=575515} Physical damage split between all enemies in the area.
Tempered Potion 1.30.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [G]:1.31
  • if_expr:buff.avenging_wrath.up

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ardent Defender6.80.047.7s49.1s1.9s4.37%4.30%0.0 (0.0)1.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_ardent_defender
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.2s / 60.0s
  • trigger_min/max:34.0s / 60.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:2.58% / 6.40%

Stack Uptimes

  • ardent_defender_1:4.37%

Spelldata

  • id:31850
  • name:Ardent Defender
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Avenging Wrath4.30.080.3s82.4s31.0s44.43%45.58%0.0 (0.0)3.8

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:63.1s / 91.6s
  • trigger_min/max:69.0s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s
  • uptime_min/max:38.60% / 52.48%

Stack Uptimes

  • avenging_wrath_1:44.43%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barricade of Faith18.010.416.8s10.5s13.8s83.13%66.79%10.4 (10.4)17.2

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_barricade_of_faith
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 87.2s
  • trigger_min/max:0.9s / 22.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.8s
  • uptime_min/max:75.38% / 90.01%

Stack Uptimes

  • barricade_of_faith_1:83.13%

Spelldata

  • id:385726
  • name:Barricade of Faith
  • tooltip:
  • description:When you use Avenger's Shield, your block chance is increased by {$385724s1=10}% for {$385724d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Blessed Hammer (_absorb)106.30.02.7s2.7s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_blessed_hammer_absorb
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 26.0s
  • trigger_min/max:0.0s / 26.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Dawn64.10.04.7s4.7s1.9s24.14%50.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 13.0s
  • trigger_min/max:2.5s / 12.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.5s
  • uptime_min/max:8.12% / 38.84%

Stack Uptimes

  • blessing_of_dawn_1:24.12%
  • blessing_of_dawn_2:0.02%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.462.5152.4s4.7s214.3s98.87%99.86%62.5 (62.5)0.4

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.5s / 343.3s
  • trigger_min/max:0.6s / 15.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.0s
  • uptime_min/max:96.78% / 99.24%

Stack Uptimes

  • blessing_of_dusk_1:98.87%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by $s2%, and Holy Power generating abilities cool down $s3% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for $s9% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Order34.60.78.6s8.4s0.9s10.79%50.45%0.7 (0.7)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_bulwark_of_order
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.8s / 22.5s
  • trigger_min/max:0.8s / 22.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.9s
  • uptime_min/max:6.31% / 15.96%

Stack Uptimes

  • bulwark_of_order_1:10.79%

Spelldata

  • id:209389
  • name:Bulwark of Order
  • tooltip:
  • description:Avenger's Shield also shields you for {$209388d=8 seconds}, absorbing {$s1=60}% as much damage as it dealt, up to {$s2=50}% of your maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Purpose19.20.114.9s14.8s0.9s5.42%13.87%0.1 (0.1)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 199.1s
  • trigger_min/max:0.0s / 199.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s
  • uptime_min/max:0.69% / 12.24%

Stack Uptimes

  • divine_purpose_1:5.42%

Spelldata

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=15}% increased damage and healing.
  • description:{$@spelldesc223817=Holy Power spending abilities have a {$s1=15}% chance to make your next Holy Power spending ability free and deal {$223819s2=15}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Faith's Armor22.374.213.4s3.1s12.2s90.83%76.18%74.2 (74.2)21.4

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_faiths_armor
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.5s / 85.3s
  • trigger_min/max:1.0s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.8s
  • uptime_min/max:84.97% / 96.18%

Stack Uptimes

  • faiths_armor_1:90.83%

Spelldata

  • id:379017
  • name:Faith's Armor
  • tooltip:Armor increased by {$=}w1%.
  • description:{$?=}c2[Shield of the Righteous][Word of Glory] grants {$s1=20}% bonus armor for {$d=4.500 seconds}.
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s76.9s35.5s25.14%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 333.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.23%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.14%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.7s76.5s35.4s25.12%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 348.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 197.6s
  • uptime_min/max:0.00% / 88.23%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.12%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.9s76.6s35.2s25.06%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 350.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 85.44%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.06%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.4s77.0s35.3s24.68%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 349.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 84.92%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.68%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)6.00.047.6s47.6s7.1s14.24%14.61%0.0 (0.0)0.1

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:14.24%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=true}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)7.70.041.7s41.7s1.3s3.33%11.95%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.2s / 61.3s
  • trigger_min/max:40.2s / 61.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.1s
  • uptime_min/max:2.65% / 5.32%

Stack Uptimes

  • hammer_of_light_ready_1:3.33%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$s2=0} Holy damage and {$429826s1=0} Holy damage up to {$s1=4} nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance7.0386.845.7s0.8s41.9s97.87%0.00%0.1 (0.1)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_lights_deliverance
  • max_stacks:60
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.4s / 89.4s
  • trigger_min/max:0.0s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 89.2s
  • uptime_min/max:95.55% / 99.30%

Stack Uptimes

  • lights_deliverance_1:1.42%
  • lights_deliverance_2:1.42%
  • lights_deliverance_3:1.36%
  • lights_deliverance_4:1.30%
  • lights_deliverance_5:1.37%
  • lights_deliverance_6:1.41%
  • lights_deliverance_7:1.61%
  • lights_deliverance_8:1.48%
  • lights_deliverance_9:1.41%
  • lights_deliverance_10:1.60%
  • lights_deliverance_11:1.38%
  • lights_deliverance_12:1.28%
  • lights_deliverance_13:1.31%
  • lights_deliverance_14:1.18%
  • lights_deliverance_15:1.20%
  • lights_deliverance_16:1.34%
  • lights_deliverance_17:1.35%
  • lights_deliverance_18:1.41%
  • lights_deliverance_19:1.60%
  • lights_deliverance_20:1.58%
  • lights_deliverance_21:1.69%
  • lights_deliverance_22:1.78%
  • lights_deliverance_23:1.82%
  • lights_deliverance_24:1.81%
  • lights_deliverance_25:1.87%
  • lights_deliverance_26:1.89%
  • lights_deliverance_27:1.85%
  • lights_deliverance_28:1.88%
  • lights_deliverance_29:1.86%
  • lights_deliverance_30:1.80%
  • lights_deliverance_31:1.82%
  • lights_deliverance_32:1.81%
  • lights_deliverance_33:1.77%
  • lights_deliverance_34:1.77%
  • lights_deliverance_35:1.75%
  • lights_deliverance_36:1.72%
  • lights_deliverance_37:1.74%
  • lights_deliverance_38:1.73%
  • lights_deliverance_39:1.73%
  • lights_deliverance_40:1.75%
  • lights_deliverance_41:1.77%
  • lights_deliverance_42:1.78%
  • lights_deliverance_43:1.81%
  • lights_deliverance_44:1.84%
  • lights_deliverance_45:1.82%
  • lights_deliverance_46:1.83%
  • lights_deliverance_47:1.83%
  • lights_deliverance_48:1.82%
  • lights_deliverance_49:1.80%
  • lights_deliverance_50:1.79%
  • lights_deliverance_51:1.77%
  • lights_deliverance_52:1.76%
  • lights_deliverance_53:1.75%
  • lights_deliverance_54:1.76%
  • lights_deliverance_55:1.74%
  • lights_deliverance_56:1.74%
  • lights_deliverance_57:1.77%
  • lights_deliverance_58:1.79%
  • lights_deliverance_59:1.81%
  • lights_deliverance_60:0.07%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=true}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Redoubt1.195.4142.8s3.1s279.7s99.09%98.85%93.3 (93.3)0.1

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_redoubt
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.1s / 303.8s
  • trigger_min/max:1.0s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:3.3s / 358.0s
  • uptime_min/max:97.76% / 99.49%

Stack Uptimes

  • redoubt_1:0.55%
  • redoubt_2:0.71%
  • redoubt_3:97.83%

Spelldata

  • id:280375
  • name:Redoubt
  • tooltip:Strength and Stamina increased by {$=}w1%.
  • description:{$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Relentless Inquisitor1.0113.60.0s2.6s298.1s99.35%91.84%111.6 (111.6)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:3
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 11.7s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.18% / 99.49%

Stack Uptimes

  • relentless_inquisitor_1:0.25%
  • relentless_inquisitor_2:0.49%
  • relentless_inquisitor_3:98.61%

Spelldata

  • id:383389
  • name:Relentless Inquisitor
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc383388=Spending Holy Power grants you {$s1=1}% haste per finisher for {$383389d=12 seconds}, stacking up to {$=}{{$s2=0}+{$s3=3}} times.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Sacrosanct Crusade7.71.041.7s36.3s3.0s7.70%66.60%1.0 (1.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:40.2s / 61.3s
  • trigger_min/max:0.9s / 61.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:3.71% / 12.26%

Stack Uptimes

  • sacrosanct_crusade_1:7.70%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=true}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=true}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=true}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=true}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification88.40.0145.6s3.4s300.0s99.99%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 359.6s
  • trigger_min/max:0.8s / 9.2s
  • trigger_pct:99.99%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:99.98% / 100.00%

Stack Uptimes

  • sanctification_1:2.18%
  • sanctification_2:27.75%
  • sanctification_3:50.75%
  • sanctification_4:16.46%
  • sanctification_5:2.74%
  • sanctification_6:0.11%
  • sanctification_7:0.00%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shake the Heavens6.66.946.1s46.1s39.9s88.03%88.46%136.0 (129.1)5.7

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:88.03%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of the Righteous15.294.820.3s2.7s19.6s98.94%99.58%94.8 (94.8)1.9

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 53.7s
  • trigger_min/max:0.0s / 11.7s
  • trigger_pct:114.05%
  • duration_min/max:0.0s / 53.7s
  • uptime_min/max:95.14% / 99.49%

Stack Uptimes

  • shield_of_the_righteous_1:98.94%

Spelldata

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Armor increased by {$?=}c1[{$=}{{$=}W1*{$=}INT/100}][{$=}{{$=}W1*{$=}STR/100}].{$?=}{$=}W3<0[ Damage taken reduced by {$=}w3%.][]
  • description:{$@spelldesc53600=Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][] }
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Shining Light (_free)2.129.781.8s9.4s136.1s95.76%100.00%25.3 (25.3)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_shining_light_free
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.3s / 250.5s
  • trigger_min/max:3.0s / 22.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 355.9s
  • uptime_min/max:82.16% / 98.92%

Stack Uptimes

  • shining_light_free_1:11.42%
  • shining_light_free_2:84.34%

Spelldata

  • id:327510
  • name:Shining Light
  • tooltip:Your next Word of Glory costs no Holy Power.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Shining Light (_stacks)32.532.29.3s4.6s6.1s66.25%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_shining_light_stacks
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 24.5s
  • trigger_min/max:1.0s / 17.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.5s
  • uptime_min/max:57.07% / 75.47%

Stack Uptimes

  • shining_light_stacks_1:33.17%
  • shining_light_stacks_2:33.09%

Spelldata

  • id:182104
  • name:Shining Light
  • tooltip:After {$=}{{$321136s1=3}~-{$=}w1} {$?=}{$=}w1<{$=}w2[Shields][Shield] of the Righteous, your next Word of Glory is free.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:4
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Tempered Potion1.30.0322.0s0.0s27.2s11.73%0.00%0.0 (0.0)1.1

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.1s / 339.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:8.91% / 17.92%

Stack Uptimes

  • tempered_potion_1:11.73%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Undisputed Ruling12.51.025.0s22.9s6.2s25.83%46.15%1.0 (1.0)12.1

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:25.83%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light {$?a137028=true}[grants Shield of the Righteous, erupts a Consecration beneath its target][applies Judgment to its targets], and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=true}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devotion Aura

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_devotion_aura
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:465
  • name:Devotion Aura
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Stormbringer's Runed Citrine

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_stormbringers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:585.63
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:585.63
  • stat:haste_rating
  • amount:585.63
  • stat:mastery_rating
  • amount:585.63
  • stat:versatility_rating
  • amount:585.63

Spelldata

  • id:462536
  • name:Stormbringer's Runed Citrine
  • tooltip:
  • description:Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windsinger's Runed Citrine (Crit)

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_windsingers_runed_citrine_Crit
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2342.53
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2342.53

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Haste)

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_windsingers_runed_citrine_Haste
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2342.53
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2342.53

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Mastery)

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2342.53
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2342.53

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Vers)

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2342.53
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2342.53

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Avenger's Shield: Grand Crusader11.82.024.023.5s1.2s243.9s
Avenger's Shield: Grand Crusader wasted0.30.04.0116.0s2.0s324.0s
Divine Purpose19.34.042.015.1s0.0s199.1s
Skyfury (Main Hand)30.211.057.09.7s0.8s119.5s
parry_haste10.10.025.027.1s2.0s304.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Avenger's Shield (_dt)29.8784.33540.562220.040171.295270.681
(hammer_of_light_) Consecration15.4260.00046.924214.231164.634274.141
Consecration27.9040.000209.671274.815208.610346.979
Avenging Wrath0.4570.0002.7491.9650.0006.359
Divine Toll1.2660.0007.0578.8384.48819.989
Ardent Defender0.0000.0000.2040.0000.0000.204
Judgment0.0060.0002.3150.5230.0004.448
Eye of Tyr1.4600.00021.10011.2531.93931.915
Shield of the Righteous2.3300.14413.296226.082171.184281.232
Avenger's Shield1.5090.00012.84543.18915.11490.306
Blessed Hammer0.5080.00020.62535.12810.19479.565
Hammer of Wrath4.5950.00061.704134.97586.494178.161

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Araylini
Blessed HammerHoly Power68.0368.0226.53%1.000.010.02%
Blessed Hammer (_absorb)Health106.322,551,906.766.51%24,002.280.000.00%
Divine TollHoly Power6.976.962.71%1.000.010.13%
Eye of TyrHoly Power7.6723.008.97%3.000.010.04%
Hammer of WrathHoly Power29.3629.3511.45%1.000.010.04%
JudgmentHoly Power88.36129.0950.34%1.460.620.48%
Sacrosanct Crusade (_heal)Health13.5420,273,747.2151.69%1,497,216.851,525,121.007.00%
Word of GloryHealth4.5416,397,917.6241.81%3,612,068.220.000.00%
Usage Type Count Total Tot% Avg RPE APR
Araylini
Hammer of LightHoly Power13.5422.788.92%1.681.681,046,417.45
Shield of the RighteousHoly Power96.47232.5091.08%2.412.4173,102.96
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health8,971,300.0786,057.561,258,342.933,142,436.3-124,777,011.5-199,793,708.9-52,052,517.5
Holy Power0.00.850.850.71.10.05.0

Statistics & Data Analysis

Fight Length
Araylini Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Araylini Damage Per Second
Count 9999
Mean 666633.06
Minimum 598533.61
Maximum 744674.43
Spread ( max - min ) 146140.82
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 20084.0483
5th Percentile 632647.38
95th Percentile 699839.63
( 95th Percentile - 5th Percentile ) 67192.25
Mean Distribution
Standard Deviation 200.8505
95.00% Confidence Interval ( 666239.40 - 667026.72 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3487
0.1 Scale Factor Error with Delta=300 3443390
0.05 Scale Factor Error with Delta=300 13773560
0.01 Scale Factor Error with Delta=300 344338977
Priority Target DPS
Araylini Priority Target Damage Per Second
Count 9999
Mean 666633.06
Minimum 598533.61
Maximum 744674.43
Spread ( max - min ) 146140.82
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 20084.0483
5th Percentile 632647.38
95th Percentile 699839.63
( 95th Percentile - 5th Percentile ) 67192.25
Mean Distribution
Standard Deviation 200.8505
95.00% Confidence Interval ( 666239.40 - 667026.72 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3487
0.1 Scale Factor Error with Delta=300 3443390
0.05 Scale Factor Error with Delta=300 13773560
0.01 Scale Factor Error with Delta=300 344338977
DPS(e)
Araylini Damage Per Second (Effective)
Count 9999
Mean 666633.06
Minimum 598533.61
Maximum 744674.43
Spread ( max - min ) 146140.82
Range [ ( max - min ) / 2 * 100% ] 10.96%
Damage
Araylini Damage
Count 9999
Mean 199853208.29
Minimum 147365021.52
Maximum 253460255.24
Spread ( max - min ) 106095233.72
Range [ ( max - min ) / 2 * 100% ] 26.54%
DTPS
Araylini Damage Taken Per Second
Count 9999
Mean 1258447.92
Minimum 1076418.53
Maximum 1452970.69
Spread ( max - min ) 376552.16
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 50445.8991
5th Percentile 1174919.89
95th Percentile 1341458.22
( 95th Percentile - 5th Percentile ) 166538.32
Mean Distribution
Standard Deviation 504.4842
95.00% Confidence Interval ( 1257459.15 - 1259436.69 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6173
0.1 Scale Factor Error with Delta=300 21723781
0.05 Scale Factor Error with Delta=300 86895122
0.01 Scale Factor Error with Delta=300 2172378034
HPS
Araylini Healing Per Second
Count 9999
Mean 121938.96
Minimum 56298.33
Maximum 235925.86
Spread ( max - min ) 179627.53
Range [ ( max - min ) / 2 * 100% ] 73.65%
Standard Deviation 22924.9089
5th Percentile 86603.99
95th Percentile 161437.68
( 95th Percentile - 5th Percentile ) 74833.68
Mean Distribution
Standard Deviation 229.2606
95.00% Confidence Interval ( 121489.61 - 122388.30 )
Normalized 95.00% Confidence Interval ( 99.63% - 100.37% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1358
0.1% Error 135778
0.1 Scale Factor Error with Delta=300 4486410
0.05 Scale Factor Error with Delta=300 17945638
0.01 Scale Factor Error with Delta=300 448640944
HPS(e)
Araylini Healing Per Second (Effective)
Count 9999
Mean 121938.96
Minimum 56298.33
Maximum 235925.86
Spread ( max - min ) 179627.53
Range [ ( max - min ) / 2 * 100% ] 73.65%
Heal
Araylini Heal
Count 9999
Mean 36668689.33
Minimum 14549661.00
Maximum 68154468.21
Spread ( max - min ) 53604807.21
Range [ ( max - min ) / 2 * 100% ] 73.09%
HTPS
Araylini Healing Taken Per Second
Count 9999
Mean 419026.73
Minimum 354047.97
Maximum 530867.61
Spread ( max - min ) 176819.64
Range [ ( max - min ) / 2 * 100% ] 21.10%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 rite_of_sanctification
1 0.00 rite_of_adjuration
2 0.00 snapshot_stats
3 0.00 devotion_aura
4 0.00 lights_judgment
5 0.00 arcane_torrent
6 0.00 consecration
7 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_cooldown&trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)|!trinket.2.has_cooldown
8 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_cooldown&trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)|!trinket.1.has_cooldown
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_attack
A 0.00 call_action_list,name=cooldowns
B 0.00 call_action_list,name=defensives
C 0.00 call_action_list,name=trinkets
D 0.00 call_action_list,name=standard
actions.cooldowns
# count action,conditions
E 1.51 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
F 4.29 avenging_wrath
G 1.31 potion,if=buff.avenging_wrath.up
0.00 moment_of_glory,if=(buff.avenging_wrath.remains<15|(time>10))
0.00 divine_toll,if=spell_targets.shield_of_the_righteous>=3
0.00 bastion_of_light,if=buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up
0.00 fireblood,if=buff.avenging_wrath.remains>8
actions.defensives
# count action,conditions
H 6.81 ardent_defender
actions.standard
# count action,conditions
I 23.09 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
J 13.54 hammer_of_light,if=buff.hammer_of_light_free.remains<2|buff.shake_the_heavens.remains<1|!buff.shake_the_heavens.up|cooldown.eye_of_tyr.remains<1.5|fight_remains<2
K 4.87 eye_of_tyr,if=(hpg_to_2dawn=5|!talent.of_dusk_and_dawn.enabled)&talent.lights_guidance.enabled
L 2.80 eye_of_tyr,if=(hpg_to_2dawn=1|buff.blessing_of_dawn.stack>0)&talent.lights_guidance.enabled
0.00 shield_of_the_righteous,if=!buff.hammer_of_light_ready.up&(buff.luck_of_the_draw.up&((holy_power+judgment_holy_power>=5)|(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)))
0.00 shield_of_the_righteous,if=!buff.hammer_of_light_ready.up&set_bonus.thewarwithin_season_2_4pc&((holy_power+judgment_holy_power>5)|(holy_power+judgment_holy_power>=5&cooldown.righteous_protector_icd.remains=0))
M 96.47 shield_of_the_righteous,if=!set_bonus.thewarwithin_season_2_4pc&(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=spell_targets.shield_of_the_righteous>3&buff.bulwark_of_righteous_fury.stack>=3&holy_power<3
0.00 avengers_shield,if=!buff.bulwark_of_righteous_fury.up&talent.bulwark_of_righteous_fury.enabled&spell_targets.shield_of_the_righteous>=3
0.00 hammer_of_the_righteous,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
0.00 blessed_hammer,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
0.00 crusader_strike,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2&!buff.avenging_wrath.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
0.00 consecration,if=buff.divine_guidance.stack=5
0.00 holy_armaments,if=next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
N 29.36 hammer_of_wrath
O 6.97 divine_toll,if=(!raid_event.adds.exists|raid_event.adds.in>10)
P 28.41 avengers_shield,if=talent.refining_fire.enabled
0.00 judgment,target_if=min:debuff.judgment.remains,if=(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
0.00 holy_armaments,if=next_armament=holy_bulwark&charges=2
Q 65.28 judgment,target_if=min:debuff.judgment.remains
0.00 avengers_shield,if=!buff.shake_the_heavens.up&talent.shake_the_heavens.enabled
0.00 hammer_of_the_righteous,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
R 63.27 blessed_hammer,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
0.00 crusader_strike,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2)|buff.shake_the_heavens.up
0.00 avengers_shield,if=!talent.lights_guidance.enabled
S 6.33 consecration,if=!consecration.up
0.00 eye_of_tyr,if=(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled
0.00 holy_armaments,if=next_armament=holy_bulwark
T 4.77 blessed_hammer
0.00 hammer_of_the_righteous
0.00 crusader_strike
U 4.53 word_of_glory,if=buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))
0.00 avengers_shield
0.00 eye_of_tyr,if=!talent.lights_deliverance.enabled
V 0.01 word_of_glory,if=buff.shining_light_free.up
0.00 arcane_torrent,if=holy_power<5
W 0.13 consecration
actions.trinkets
# count action,conditions
0.00 use_item,name=tome_of_lights_devotion,if=buff.inner_resilience.up
X 3.65 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)
Y 2.82 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)

Sample Sequence

3469FGHXIKJMIMNOMIPQMNQMRRMQMNMRRPQMNQMRYRMQMNMRQMPRNQMRSQMNRMQPRMQURJKHJMIMQPRIMPOIQMRPIQMMRRQMRPQQMMRPQQMMPMFNQMMSMQTMMNKJIMHPNIMQXPQMNRMOJMMIMNQMRPQMNQMRRRMQRPIMMQRSQMKJQRPIMPQRPIMQHRRMQJMYOQMRPQRMEQRRMRQFNMPQRMRNQMSQMMKJNPQMRQMNRQMMRXPNMIQMHROMJQRQMPRQRMRQRMPQRQMSPILJMIQMRPIQMRRIMPQRQMRRPIMJOIQMHRNFQMRPQMNRMQRMRLJNIMMPQMMRMNYQMRQMPNQMRQMRNMQRRMMJMNIXOMHMPMQNQMRRQMNLJPQENM

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre3devotion_aura
[precombat]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
Pre4lights_judgment
[precombat]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
Pre6consecration
[precombat]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
0:00.0009auto_attack
[default]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
0:00.000Favenging_wrath
[cooldowns]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
bloodlust
0:00.000Gpotion
[cooldowns]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath
0:00.000Hardent_defender
[defensives]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, tempered_potion
0:00.000Xuse_items
[trinkets]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, avenging_wrath, tempered_potion
0:00.000Ijudgment
[standard]
Fluffy_Pillow 8971300.0/8971300 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, avenging_wrath, tempered_potion
0:00.988Keye_of_tyr
[standard]
Fluffy_Pillow 8971300.0/8971300 100% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, avenging_wrath, sanctification, tempered_potion
0:01.977Jhammer_of_light
[standard]
Fluffy_Pillow 8971300.0/8971300 100% HP
5.0/5 100% HoPo
bloodlust, ardent_defender, avenging_wrath, hammer_of_light_ready, sanctification, sacrosanct_crusade, tempered_potion
0:01.977Mshield_of_the_righteous
[standard]
Fluffy_Pillow 8971300.0/8971300 100% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, shield_of_the_righteous, avenging_wrath, divine_purpose, relentless_inquisitor, undisputed_ruling, sanctification, lights_deliverance, sacrosanct_crusade, tempered_potion
0:02.964Ijudgment
[standard]
Fluffy_Pillow 9150720.0/9150720 100% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt, shield_of_the_righteous, shining_light_stacks, avenging_wrath, faiths_armor, relentless_inquisitor(2), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(6), sacrosanct_crusade, tempered_potion
0:03.058Mshield_of_the_righteous
[standard]
Fluffy_Pillow 9150720.0/9150720 100% HP
4.0/5 80% HoPo
bloodlust, ardent_defender, redoubt, shield_of_the_righteous, shining_light_stacks, avenging_wrath, blessing_of_dawn, faiths_armor, relentless_inquisitor(2), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, tempered_potion
0:03.827Nhammer_of_wrath
[standard]
Fluffy_Pillow 9330160.0/9330160 100% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, tempered_potion
0:04.684Odivine_toll
[standard]
Fluffy_Pillow 6873841.2/9330160 74% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), tempered_potion
0:04.684Mshield_of_the_righteous
[standard]
Fluffy_Pillow 6873841.2/9330160 74% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), tempered_potion
0:05.541Ijudgment
[standard]
Fluffy_Pillow 8506025.9/9509580 89% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(11), tempered_potion
0:06.397Pavengers_shield
[standard]
Fluffy_Pillow 7279359.4/9509580 77% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), tempered_potion
0:07.254Qjudgment
[standard]
Fluffy_Pillow 6660121.3/9509580 70% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), tempered_potion
0:07.254Mshield_of_the_righteous
[standard]
Fluffy_Pillow 6660121.3/9509580 70% HP
4.0/5 80% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), tempered_potion
0:08.109Nhammer_of_wrath
[standard]
Fluffy_Pillow 4006373.2/9509580 42% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(14), tempered_potion
0:09.067Qjudgment
[standard]
Fluffy_Pillow 3003936.6/9509580 32% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(15), tempered_potion
0:09.067Mshield_of_the_righteous
[standard]
Fluffy_Pillow 3003936.6/9509580 32% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(15), tempered_potion
0:10.026Rblessed_hammer
[standard]
Fluffy_Pillow 620861.7/9509580 7% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(5), lights_deliverance(17), tempered_potion
0:10.985Rblessed_hammer
[standard]
Fluffy_Pillow 620861.7/9509580 7% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(18), flask_of_alchemical_chaos_crit, tempered_potion
0:10.985Mshield_of_the_righteous
[standard]
Fluffy_Pillow 620861.7/9509580 7% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(18), flask_of_alchemical_chaos_crit, tempered_potion
0:11.943Qjudgment
[standard]
Fluffy_Pillow -383507.0/9509580 -4% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(20), flask_of_alchemical_chaos_crit, tempered_potion
0:12.029Mshield_of_the_righteous
[standard]
Fluffy_Pillow -3091540.0/9509580 -33% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(5), lights_deliverance(20), flask_of_alchemical_chaos_crit, tempered_potion
0:12.903Nhammer_of_wrath
[standard]
Fluffy_Pillow -3091540.0/9509580 -33% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(5), lights_deliverance(23), flask_of_alchemical_chaos_crit, tempered_potion
0:13.102Mshield_of_the_righteous
[standard]
Fluffy_Pillow -4095908.7/9509580 -43% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(23), flask_of_alchemical_chaos_crit, tempered_potion
0:13.862Rblessed_hammer
[standard]
Fluffy_Pillow -4095908.7/9509580 -43% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(25), flask_of_alchemical_chaos_crit, tempered_potion
0:14.821Rblessed_hammer
[standard]
Fluffy_Pillow -6757455.1/9509580 -71% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(26), flask_of_alchemical_chaos_crit, tempered_potion
0:15.779Pavengers_shield
[standard]
Fluffy_Pillow -6261823.8/9509580 -66% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_crit, tempered_potion
0:16.739Qjudgment
[standard]
Fluffy_Pillow -8813983.1/9509580 -93% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_crit, tempered_potion
0:16.739Mshield_of_the_righteous
[standard]
Fluffy_Pillow -8813983.1/9509580 -93% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_crit, tempered_potion
0:17.697Nhammer_of_wrath
[standard]
Fluffy_Pillow -9961318.5/9509580 -105% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_crit, tempered_potion
0:18.656Qjudgment
[standard]
Fluffy_Pillow -13021860.0/9509580 -137% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(30), flask_of_alchemical_chaos_crit, tempered_potion
0:18.656Mshield_of_the_righteous
[standard]
Fluffy_Pillow -13021860.0/9509580 -137% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(30), flask_of_alchemical_chaos_crit, tempered_potion
0:19.614Rblessed_hammer
[standard]
Fluffy_Pillow -14193525.7/9509580 -149% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(32), flask_of_alchemical_chaos_crit, tempered_potion
0:20.571Yuse_items
[trinkets]
Fluffy_Pillow -15826421.9/9509580 -166% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_crit, tempered_potion
0:20.571Rblessed_hammer
[standard]
Fluffy_Pillow -15826421.9/9509580 -166% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_crit, tempered_potion
0:20.571Mshield_of_the_righteous
[standard]
Fluffy_Pillow -15826421.9/9509580 -166% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_crit, tempered_potion
0:21.529Qjudgment
[standard]
Fluffy_Pillow -16973757.3/9509580 -178% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_crit, tempered_potion
0:21.613Mshield_of_the_righteous
[standard]
Fluffy_Pillow -16973757.3/9509580 -178% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(35), flask_of_alchemical_chaos_crit, tempered_potion
0:22.487Nhammer_of_wrath
[standard]
Fluffy_Pillow -21655375.5/9509580 -228% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(38), flask_of_alchemical_chaos_crit, tempered_potion
0:22.645Mshield_of_the_righteous
[standard]
Fluffy_Pillow -21655375.5/9509580 -228% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(38), flask_of_alchemical_chaos_crit, tempered_potion
0:23.446Rblessed_hammer
[standard]
Fluffy_Pillow -22802710.9/9509580 -240% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(40), flask_of_alchemical_chaos_crit, tempered_potion
0:24.405Qjudgment
[standard]
Fluffy_Pillow -25935351.5/9509580 -273% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(41), flask_of_alchemical_chaos_crit, tempered_potion
0:24.538Mshield_of_the_righteous
[standard]
Fluffy_Pillow -25935351.5/9509580 -273% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(41), flask_of_alchemical_chaos_crit, tempered_potion
0:25.496Pavengers_shield
[standard]
Fluffy_Pillow -25607017.2/9509580 -269% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(43), flask_of_alchemical_chaos_crit, tempered_potion
0:26.454Rblessed_hammer
[standard]
Fluffy_Pillow -30071389.8/9509580 -316% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(44), flask_of_alchemical_chaos_crit, tempered_potion
0:27.413Nhammer_of_wrath
[standard]
Fluffy_Pillow -31218725.2/9509580 -328% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(44), flask_of_alchemical_chaos_crit, tempered_potion
0:28.371Qjudgment
[standard]
Fluffy_Pillow -34330250.6/9509580 -361% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_crit, tempered_potion
0:28.371Mshield_of_the_righteous
[standard]
Fluffy_Pillow -34330250.6/9509580 -361% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_crit, tempered_potion
0:29.328Rblessed_hammer
[standard]
Fluffy_Pillow -35477586.0/9509580 -373% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_crit, tempered_potion
0:30.288Sconsecration
[standard]
Fluffy_Pillow -38608129.0/9509580 -406% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_crit
0:31.280Qjudgment
[standard]
Fluffy_Pillow -39668523.5/9509580 -417% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_crit
0:31.280Mshield_of_the_righteous
[standard]
Fluffy_Pillow -39668523.5/9509580 -417% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_crit
0:32.272Nhammer_of_wrath
[standard]
Fluffy_Pillow -39668523.5/9509580 -417% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(50), flask_of_alchemical_chaos_crit
0:33.264Rblessed_hammer
[standard]
Fluffy_Pillow -40705311.0/9509580 -428% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(51), flask_of_alchemical_chaos_crit
0:33.264Mshield_of_the_righteous
[standard]
Fluffy_Pillow -40705311.0/9509580 -428% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(51), flask_of_alchemical_chaos_crit
0:34.255Qjudgment
[standard]
Fluffy_Pillow -40705311.0/9509580 -428% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(53), flask_of_alchemical_chaos_crit
0:35.247Pavengers_shield
[standard]
Fluffy_Pillow -40242098.4/9509580 -423% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(54), flask_of_alchemical_chaos_crit
0:36.238Rblessed_hammer
[standard]
Fluffy_Pillow -40242098.4/9509580 -423% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(54), flask_of_alchemical_chaos_crit
0:36.238Mshield_of_the_righteous
[standard]
Fluffy_Pillow -40242098.4/9509580 -423% HP
3.0/5 60% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(54), flask_of_alchemical_chaos_crit
0:37.229Qjudgment
[standard]
Fluffy_Pillow -41140354.0/9509580 -433% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(57), flask_of_alchemical_chaos_crit
0:38.374Uword_of_glory
[standard]
Araylini -41140354.0/9509580 -433% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(58), flask_of_alchemical_chaos_crit
0:39.367Rblessed_hammer
[standard]
Fluffy_Pillow -38626607.3/9509580 -406% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), flask_of_alchemical_chaos_crit
0:40.359Jhammer_of_light
[standard]
Fluffy_Pillow -37126607.3/9509580 -390% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, flask_of_alchemical_chaos_haste
0:41.587Keye_of_tyr
[standard]
Fluffy_Pillow -36546765.7/9509580 -384% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), flask_of_alchemical_chaos_haste
0:42.000Hardent_defender
[defensives]
Fluffy_Pillow -36546765.7/9509580 -384% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_ready, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:42.682Jhammer_of_light
[standard]
Fluffy_Pillow -36546765.7/9509580 -384% HP
5.0/5 100% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_ready, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:42.682Mshield_of_the_righteous
[standard]
Fluffy_Pillow -34930136.7/9509580 -367% HP
2.0/5 40% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, divine_purpose, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:43.779Ijudgment
[standard]
Fluffy_Pillow -15910976.7/9509580 -167% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:43.779Mshield_of_the_righteous
[standard]
Fluffy_Pillow -15910976.7/9509580 -167% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:44.875Qjudgment
[standard]
Fluffy_Pillow -15910976.7/9509580 -167% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:45.970Pavengers_shield
[standard]
Fluffy_Pillow -14410976.7/9509580 -152% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:47.066Rblessed_hammer
[standard]
Fluffy_Pillow -14410976.7/9509580 -152% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:48.162Ijudgment
[standard]
Fluffy_Pillow -14410976.7/9509580 -152% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:48.162Mshield_of_the_righteous
[standard]
Fluffy_Pillow -14410976.7/9509580 -152% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:49.257Pavengers_shield
[standard]
Fluffy_Pillow -15093824.0/9509580 -159% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_haste
0:50.484Odivine_toll
[standard]
Fluffy_Pillow -13593824.0/9509580 -143% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_haste
0:51.711Ijudgment
[standard]
Fluffy_Pillow -14353547.8/9509580 -151% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_haste
0:52.936Qjudgment
[standard]
Fluffy_Pillow -14353547.8/9509580 -151% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(23), flask_of_alchemical_chaos_haste
0:52.936Mshield_of_the_righteous
[standard]
Fluffy_Pillow -14353547.8/9509580 -151% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(23), flask_of_alchemical_chaos_haste
0:54.161Rblessed_hammer
[standard]
Fluffy_Pillow -15413942.2/9509580 -162% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(25), flask_of_alchemical_chaos_haste
0:55.387Pavengers_shield
[standard]
Fluffy_Pillow -14950729.7/9509580 -157% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_haste
0:56.610Ijudgment
[standard]
Fluffy_Pillow -14950729.7/9509580 -157% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_haste
0:57.838Qjudgment
[standard]
Fluffy_Pillow -15710453.5/9509580 -165% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(27), flask_of_alchemical_chaos_haste
0:57.838Mshield_of_the_righteous
[standard]
Fluffy_Pillow -15710453.5/9509580 -165% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(27), flask_of_alchemical_chaos_haste
0:58.924Mshield_of_the_righteous
[standard]
Fluffy_Pillow -15710453.5/9509580 -165% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(30), flask_of_alchemical_chaos_haste
0:59.064Rblessed_hammer
[standard]
Fluffy_Pillow -16903989.2/9509580 -178% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(31), flask_of_alchemical_chaos_haste
1:00.290Rblessed_hammer
[standard]
Fluffy_Pillow -15403989.2/9509580 -162% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(32), flask_of_alchemical_chaos_haste
1:01.517Qjudgment
[standard]
Fluffy_Pillow -16573918.0/9509580 -174% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(33), flask_of_alchemical_chaos_haste
1:01.680Mshield_of_the_righteous
[standard]
Fluffy_Pillow -16573918.0/9509580 -174% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(33), flask_of_alchemical_chaos_haste
1:02.908Rblessed_hammer
[standard]
Fluffy_Pillow -25967867.3/9509580 -273% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(36), flask_of_alchemical_chaos_haste
1:04.134Pavengers_shield
[standard]
Fluffy_Pillow -31889077.1/9509580 -335% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(36), flask_of_alchemical_chaos_haste
1:05.360Qjudgment
[standard]
Fluffy_Pillow -31450677.8/9509580 -331% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(37), flask_of_alchemical_chaos_haste
1:06.586Qjudgment
[standard]
Fluffy_Pillow -36071300.0/9509580 -379% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(38), flask_of_alchemical_chaos_haste
1:06.748Mshield_of_the_righteous
[standard]
Fluffy_Pillow -36071300.0/9509580 -379% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(38), flask_of_alchemical_chaos_haste
1:07.778Mshield_of_the_righteous
[standard]
Fluffy_Pillow -36071300.0/9509580 -379% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(40), flask_of_alchemical_chaos_haste
1:07.973Rblessed_hammer
[standard]
Fluffy_Pillow -36071300.0/9509580 -379% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(41), flask_of_alchemical_chaos_haste
1:09.200Pavengers_shield
[standard]
Fluffy_Pillow -40375228.1/9509580 -425% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(43), flask_of_alchemical_chaos_haste
1:10.427Qjudgment
[standard]
Fluffy_Pillow -43076510.5/9509580 -453% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(44), flask_of_alchemical_chaos_vers
1:11.714Qjudgment
[standard]
Fluffy_Pillow -43076510.5/9509580 -453% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(44), flask_of_alchemical_chaos_vers
1:11.898Mshield_of_the_righteous
[standard]
Fluffy_Pillow -43076510.5/9509580 -453% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(44), flask_of_alchemical_chaos_vers
1:12.994Mshield_of_the_righteous
[standard]
Fluffy_Pillow -44215025.6/9509580 -465% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(45), flask_of_alchemical_chaos_vers
1:13.188Pavengers_shield
[standard]
Fluffy_Pillow -44215025.6/9509580 -465% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(46), flask_of_alchemical_chaos_vers
1:14.063Mshield_of_the_righteous
[standard]
Fluffy_Pillow -49651413.0/9509580 -522% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(46), flask_of_alchemical_chaos_vers
1:14.476Favenging_wrath
[cooldowns]
Fluffy_Pillow -49651413.0/9509580 -522% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(47), flask_of_alchemical_chaos_vers
1:14.476Nhammer_of_wrath
[standard]
Fluffy_Pillow -49651413.0/9509580 -522% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(47), flask_of_alchemical_chaos_vers
1:15.765Qjudgment
[standard]
Fluffy_Pillow -48151413.0/9509580 -506% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_vers
1:15.765Mshield_of_the_righteous
[standard]
Fluffy_Pillow -48151413.0/9509580 -506% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_vers
1:16.851Mshield_of_the_righteous
[standard]
Fluffy_Pillow -52407820.3/9509580 -551% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_vers
1:17.054Sconsecration
[standard]
Fluffy_Pillow -52407820.3/9509580 -551% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(49), flask_of_alchemical_chaos_vers
1:17.937Mshield_of_the_righteous
[standard]
Fluffy_Pillow -52407820.3/9509580 -551% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(49), flask_of_alchemical_chaos_vers
1:18.342Qjudgment
[standard]
Fluffy_Pillow -53440305.4/9509580 -562% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(50), flask_of_alchemical_chaos_vers
1:19.630Tblessed_hammer
[standard]
Fluffy_Pillow -53440305.4/9509580 -562% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(50), flask_of_alchemical_chaos_vers
1:19.630Mshield_of_the_righteous
[standard]
Fluffy_Pillow -53440305.4/9509580 -562% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(4), lights_deliverance(50), flask_of_alchemical_chaos_vers
1:20.701Mshield_of_the_righteous
[standard]
Fluffy_Pillow -55654951.8/9509580 -585% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(51), flask_of_alchemical_chaos_vers
1:20.919Nhammer_of_wrath
[standard]
Fluffy_Pillow -55654951.8/9509580 -585% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(52), flask_of_alchemical_chaos_vers
1:22.207Keye_of_tyr
[standard]
Fluffy_Pillow -56687436.9/9509580 -596% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_vers
1:23.495Jhammer_of_light
[standard]
Fluffy_Pillow -56687436.9/9509580 -596% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_ready, sanctification(2), lights_deliverance(52), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:24.784Ijudgment
[standard]
Fluffy_Pillow -55070807.9/9509580 -579% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(57), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:24.784Mshield_of_the_righteous
[standard]
Fluffy_Pillow -55070807.9/9509580 -579% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(57), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:25.935Hardent_defender
[defensives]
Fluffy_Pillow -53570807.9/9509580 -563% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(59), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:26.000Pavengers_shield
[standard]
Fluffy_Pillow -53570807.9/9509580 -563% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:27.151Nhammer_of_wrath
[standard]
Fluffy_Pillow -34551647.9/9509580 -363% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:28.301Ijudgment
[standard]
Fluffy_Pillow -37213528.2/9509580 -391% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance, flask_of_alchemical_chaos_vers
1:28.301Mshield_of_the_righteous
[standard]
Fluffy_Pillow -37213528.2/9509580 -391% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance, flask_of_alchemical_chaos_vers
1:29.453Qjudgment
[standard]
Fluffy_Pillow -37213528.2/9509580 -391% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(3), flask_of_alchemical_chaos_vers
1:30.603Xuse_items
[trinkets]
Fluffy_Pillow -36746013.2/9509580 -386% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(4), flask_of_alchemical_chaos_vers
1:30.603Pavengers_shield
[standard]
Fluffy_Pillow -36746013.2/9509580 -386% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(4), flask_of_alchemical_chaos_vers
1:31.892Qjudgment
[standard]
Fluffy_Pillow -36746013.2/9509580 -386% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(4), flask_of_alchemical_chaos_vers
1:31.892Mshield_of_the_righteous
[standard]
Fluffy_Pillow -36746013.2/9509580 -386% HP
4.0/5 80% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(4), flask_of_alchemical_chaos_vers
1:33.180Nhammer_of_wrath
[standard]
Fluffy_Pillow -37448800.1/9509580 -394% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(7), flask_of_alchemical_chaos_vers
1:34.576Rblessed_hammer
[standard]
Fluffy_Pillow -38481285.1/9509580 -405% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(8), flask_of_alchemical_chaos_vers
1:34.576Mshield_of_the_righteous
[standard]
Fluffy_Pillow -38481285.1/9509580 -405% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(8), flask_of_alchemical_chaos_vers
1:35.865Odivine_toll
[standard]
Fluffy_Pillow -36981285.1/9509580 -389% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(10), flask_of_alchemical_chaos_vers
1:37.155Jhammer_of_light
[standard]
Fluffy_Pillow -37825314.0/9509580 -398% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(11), flask_of_alchemical_chaos_vers
1:37.155Mshield_of_the_righteous
[standard]
Fluffy_Pillow -36208685.0/9509580 -381% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), flask_of_alchemical_chaos_vers
1:38.239Mshield_of_the_righteous
[standard]
Fluffy_Pillow -37217563.1/9509580 -391% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(19), flask_of_alchemical_chaos_vers
1:38.445Ijudgment
[standard]
Fluffy_Pillow -37217563.1/9509580 -391% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(21), flask_of_alchemical_chaos_vers
1:39.320Mshield_of_the_righteous
[standard]
Fluffy_Pillow -37217563.1/9509580 -391% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_vers
1:39.597Nhammer_of_wrath
[standard]
Fluffy_Pillow -37217563.1/9509580 -391% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(23), flask_of_alchemical_chaos_vers
1:40.747Qjudgment
[standard]
Fluffy_Pillow -36750048.1/9509580 -386% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_mastery
1:40.747Mshield_of_the_righteous
[standard]
Fluffy_Pillow -36750048.1/9509580 -386% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_mastery
1:41.897Rblessed_hammer
[standard]
Fluffy_Pillow -36750048.1/9509580 -386% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_mastery
1:43.047Pavengers_shield
[standard]
Fluffy_Pillow -37769309.9/9509580 -397% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(27), flask_of_alchemical_chaos_mastery
1:44.196Qjudgment
[standard]
Fluffy_Pillow -38483625.3/9509580 -405% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_mastery
1:44.196Mshield_of_the_righteous
[standard]
Fluffy_Pillow -38483625.3/9509580 -405% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_mastery
1:45.485Nhammer_of_wrath
[standard]
Fluffy_Pillow -36983625.3/9509580 -389% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(30), flask_of_alchemical_chaos_mastery
1:46.878Qjudgment
[standard]
Fluffy_Pillow -38002887.1/9509580 -400% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_mastery
1:46.878Mshield_of_the_righteous
[standard]
Fluffy_Pillow -38002887.1/9509580 -400% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_mastery
1:48.166Rblessed_hammer
[standard]
Fluffy_Pillow -39046715.3/9509580 -411% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(34), flask_of_alchemical_chaos_mastery
1:49.453Rblessed_hammer
[standard]
Fluffy_Pillow -39046715.3/9509580 -411% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(34), flask_of_alchemical_chaos_mastery
1:50.741Rblessed_hammer
[standard]
Fluffy_Pillow -38565977.1/9509580 -406% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_mastery
1:50.741Mshield_of_the_righteous
[standard]
Fluffy_Pillow -38565977.1/9509580 -406% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_mastery
1:52.028Qjudgment
[standard]
Fluffy_Pillow -39734946.4/9509580 -418% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(38), flask_of_alchemical_chaos_mastery
1:53.316Rblessed_hammer
[standard]
Fluffy_Pillow -39734946.4/9509580 -418% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(38), flask_of_alchemical_chaos_mastery
1:54.606Pavengers_shield
[standard]
Fluffy_Pillow -40903915.8/9509580 -430% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(39), flask_of_alchemical_chaos_mastery
1:55.894Ijudgment
[standard]
Fluffy_Pillow -39403915.8/9509580 -414% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(39), flask_of_alchemical_chaos_mastery
1:55.894Mshield_of_the_righteous
[standard]
Fluffy_Pillow -39403915.8/9509580 -414% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(39), flask_of_alchemical_chaos_mastery
1:56.956Mshield_of_the_righteous
[standard]
Fluffy_Pillow -40435588.2/9509580 -425% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(42), flask_of_alchemical_chaos_mastery
1:57.184Qjudgment
[standard]
Fluffy_Pillow -40435588.2/9509580 -425% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(44), flask_of_alchemical_chaos_mastery
1:58.473Rblessed_hammer
[standard]
Fluffy_Pillow -41629123.9/9509580 -438% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_mastery
1:59.763Sconsecration
[standard]
Fluffy_Pillow -41629123.9/9509580 -438% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_mastery
2:01.053Qjudgment
[standard]
Fluffy_Pillow -41148385.7/9509580 -433% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(46), flask_of_alchemical_chaos_mastery
2:01.053Mshield_of_the_righteous
[standard]
Fluffy_Pillow -41148385.7/9509580 -433% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(46), flask_of_alchemical_chaos_mastery
2:02.342Keye_of_tyr
[standard]
Fluffy_Pillow -53245297.8/9509580 -560% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(49), flask_of_alchemical_chaos_mastery
2:03.693Jhammer_of_light
[standard]
Fluffy_Pillow -53245297.8/9509580 -560% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_ready, sanctification(3), lights_deliverance(50), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
2:04.982Qjudgment
[standard]
Fluffy_Pillow -52816433.3/9509580 -555% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(55), flask_of_alchemical_chaos_mastery
2:06.132Rblessed_hammer
[standard]
Fluffy_Pillow -54307546.4/9509580 -571% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(55), flask_of_alchemical_chaos_mastery
2:07.282Pavengers_shield
[standard]
Fluffy_Pillow -54307546.4/9509580 -571% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(56), flask_of_alchemical_chaos_mastery
2:08.431Ijudgment
[standard]
Fluffy_Pillow -54307546.4/9509580 -571% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(57), flask_of_alchemical_chaos_mastery
2:08.431Mshield_of_the_righteous
[standard]
Fluffy_Pillow -54307546.4/9509580 -571% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(57), flask_of_alchemical_chaos_mastery
2:09.580Pavengers_shield
[standard]
Fluffy_Pillow -55189511.2/9509580 -580% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_mastery
2:10.731Qjudgment
[standard]
Fluffy_Pillow -56374881.7/9509580 -593% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), flask_of_alchemical_chaos_haste
2:11.958Rblessed_hammer
[standard]
Fluffy_Pillow -57436655.9/9509580 -604% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), flask_of_alchemical_chaos_haste
2:13.183Pavengers_shield
[standard]
Fluffy_Pillow -61281545.6/9509580 -644% HP
2.0/5 40% HoPo
redoubt(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, flask_of_alchemical_chaos_haste
2:14.411Ijudgment
[standard]
Fluffy_Pillow -67030059.9/9509580 -705% HP
2.0/5 40% HoPo
redoubt(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), flask_of_alchemical_chaos_haste
2:14.411Mshield_of_the_righteous
[standard]
Fluffy_Pillow -67030059.9/9509580 -705% HP
3.0/5 60% HoPo
redoubt(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), flask_of_alchemical_chaos_haste
2:15.638Qjudgment
[standard]
Fluffy_Pillow -66568307.2/9509580 -700% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(4), flask_of_alchemical_chaos_haste
2:16.000Hardent_defender
[defensives]
Fluffy_Pillow -69372610.1/9509580 -730% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(4), flask_of_alchemical_chaos_haste
2:16.864Rblessed_hammer
[standard]
Fluffy_Pillow -69372610.1/9509580 -730% HP
1.0/5 20% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(5), flask_of_alchemical_chaos_haste
2:18.090Rblessed_hammer
[standard]
Fluffy_Pillow -55055699.6/9509580 -579% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(5), flask_of_alchemical_chaos_haste
2:18.090Mshield_of_the_righteous
[standard]
Fluffy_Pillow -55055699.6/9509580 -579% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(5), flask_of_alchemical_chaos_haste
2:19.317Qjudgment
[standard]
Fluffy_Pillow -56225708.4/9509580 -591% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(8), flask_of_alchemical_chaos_haste
2:20.543Jhammer_of_light
[standard]
Fluffy_Pillow -57880844.4/9509580 -609% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(9), flask_of_alchemical_chaos_haste
2:20.543Mshield_of_the_righteous
[standard]
Fluffy_Pillow -56264215.4/9509580 -592% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(10), flask_of_alchemical_chaos_haste
2:21.771Yuse_items
[trinkets]
Fluffy_Pillow -57302462.7/9509580 -603% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(16), flask_of_alchemical_chaos_haste
2:21.771Odivine_toll
[standard]
Fluffy_Pillow -57302462.7/9509580 -603% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(16), flask_of_alchemical_chaos_haste
2:22.866Qjudgment
[standard]
Fluffy_Pillow -61275718.9/9509580 -644% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(17), flask_of_alchemical_chaos_haste
2:22.866Mshield_of_the_righteous
[standard]
Fluffy_Pillow -61275718.9/9509580 -644% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(17), flask_of_alchemical_chaos_haste
2:23.962Rblessed_hammer
[standard]
Fluffy_Pillow -62337493.1/9509580 -656% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(19), flask_of_alchemical_chaos_haste
2:25.057Pavengers_shield
[standard]
Fluffy_Pillow -66142201.2/9509580 -696% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(20), flask_of_alchemical_chaos_haste
2:26.153Qjudgment
[standard]
Fluffy_Pillow -66142201.2/9509580 -696% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(21), flask_of_alchemical_chaos_haste
2:27.248Rblessed_hammer
[standard]
Fluffy_Pillow -67048961.1/9509580 -705% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_haste
2:27.248Mshield_of_the_righteous
[standard]
Fluffy_Pillow -67048961.1/9509580 -705% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_haste
2:28.474Elights_judgment
[cooldowns]
Fluffy_Pillow -69835112.1/9509580 -734% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(24), flask_of_alchemical_chaos_haste
2:29.727Qjudgment
[standard]
Fluffy_Pillow -70896886.3/9509580 -746% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_haste
2:31.149Rblessed_hammer
[standard]
Fluffy_Pillow -73288917.6/9509580 -771% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(25), flask_of_alchemical_chaos_haste
2:32.374Rblessed_hammer
[standard]
Fluffy_Pillow -73288917.6/9509580 -771% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_haste
2:32.374Mshield_of_the_righteous
[standard]
Fluffy_Pillow -73288917.6/9509580 -771% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_haste
2:33.599Rblessed_hammer
[standard]
Fluffy_Pillow -74327164.9/9509580 -782% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_haste
2:34.826Qjudgment
[standard]
Fluffy_Pillow -74327164.9/9509580 -782% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(29), flask_of_alchemical_chaos_haste
2:36.052Favenging_wrath
[cooldowns]
Fluffy_Pillow -73997173.7/9509580 -778% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_haste
2:36.052Nhammer_of_wrath
[standard]
Fluffy_Pillow -73997173.7/9509580 -778% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_haste
2:36.052Mshield_of_the_righteous
[standard]
Fluffy_Pillow -73997173.7/9509580 -778% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_haste
2:37.280Pavengers_shield
[standard]
Fluffy_Pillow -75167182.6/9509580 -790% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(32), flask_of_alchemical_chaos_haste
2:38.507Qjudgment
[standard]
Fluffy_Pillow -75167182.6/9509580 -790% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(33), flask_of_alchemical_chaos_haste
2:39.733Rblessed_hammer
[standard]
Fluffy_Pillow -76045148.6/9509580 -800% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_haste
2:39.733Mshield_of_the_righteous
[standard]
Fluffy_Pillow -76045148.6/9509580 -800% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_haste
2:40.959Rblessed_hammer
[standard]
Fluffy_Pillow -74545148.6/9509580 -784% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(36), flask_of_alchemical_chaos_crit
2:42.247Nhammer_of_wrath
[standard]
Fluffy_Pillow -75715077.3/9509580 -796% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_crit
2:43.553Qjudgment
[standard]
Fluffy_Pillow -76885006.1/9509580 -809% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_crit
2:43.553Mshield_of_the_righteous
[standard]
Fluffy_Pillow -76885006.1/9509580 -809% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_crit
2:44.841Sconsecration
[standard]
Fluffy_Pillow -76885006.1/9509580 -809% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(40), flask_of_alchemical_chaos_crit
2:46.128Qjudgment
[standard]
Fluffy_Pillow -76421793.5/9509580 -804% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(2), lights_deliverance(41), flask_of_alchemical_chaos_crit
2:46.354Mshield_of_the_righteous
[standard]
Fluffy_Pillow -76421793.5/9509580 -804% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(2), lights_deliverance(41), flask_of_alchemical_chaos_crit
2:47.383Mshield_of_the_righteous
[standard]
Fluffy_Pillow -77482188.0/9509580 -815% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(42), flask_of_alchemical_chaos_crit
2:47.641Keye_of_tyr
[standard]
Fluffy_Pillow -77482188.0/9509580 -815% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(3), lights_deliverance(43), flask_of_alchemical_chaos_crit
2:48.930Jhammer_of_light
[standard]
Fluffy_Pillow -77482188.0/9509580 -815% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_ready, sanctification(2), lights_deliverance(43), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:50.220Nhammer_of_wrath
[standard]
Fluffy_Pillow -74365559.0/9509580 -782% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(48), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:51.369Pavengers_shield
[standard]
Fluffy_Pillow -74365559.0/9509580 -782% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(48), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:52.519Qjudgment
[standard]
Fluffy_Pillow -74365559.0/9509580 -782% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(49), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:52.519Mshield_of_the_righteous
[standard]
Fluffy_Pillow -74365559.0/9509580 -782% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(49), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:53.670Rblessed_hammer
[standard]
Fluffy_Pillow -74925656.2/9509580 -788% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_crit
2:54.820Qjudgment
[standard]
Fluffy_Pillow -74925656.2/9509580 -788% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_crit
2:54.820Mshield_of_the_righteous
[standard]
Fluffy_Pillow -74925656.2/9509580 -788% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_crit
2:55.972Nhammer_of_wrath
[standard]
Fluffy_Pillow -74462443.6/9509580 -783% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(55), flask_of_alchemical_chaos_crit
2:57.362Rblessed_hammer
[standard]
Fluffy_Pillow -75499231.1/9509580 -794% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(55), flask_of_alchemical_chaos_crit
2:58.651Qjudgment
[standard]
Fluffy_Pillow -75499231.1/9509580 -794% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(56), flask_of_alchemical_chaos_crit
2:58.651Mshield_of_the_righteous
[standard]
Fluffy_Pillow -75499231.1/9509580 -794% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(56), flask_of_alchemical_chaos_crit
2:59.741Mshield_of_the_righteous
[standard]
Fluffy_Pillow -76536018.5/9509580 -805% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_crit
2:59.939Rblessed_hammer
[standard]
Fluffy_Pillow -76536018.5/9509580 -805% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), flask_of_alchemical_chaos_crit
3:01.228Xuse_items
[trinkets]
Fluffy_Pillow -76072806.0/9509580 -800% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, flask_of_alchemical_chaos_crit
3:01.228Pavengers_shield
[standard]
Fluffy_Pillow -76072806.0/9509580 -800% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, flask_of_alchemical_chaos_crit
3:02.517Nhammer_of_wrath
[standard]
Fluffy_Pillow -84322062.2/9509580 -887% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), flask_of_alchemical_chaos_crit
3:02.517Mshield_of_the_righteous
[standard]
Fluffy_Pillow -84322062.2/9509580 -887% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), flask_of_alchemical_chaos_crit
3:03.805Ijudgment
[standard]
Fluffy_Pillow -85358849.6/9509580 -898% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(5), flask_of_alchemical_chaos_crit
3:05.093Qjudgment
[standard]
Fluffy_Pillow -88264623.8/9509580 -928% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(5), flask_of_alchemical_chaos_crit
3:05.093Mshield_of_the_righteous
[standard]
Fluffy_Pillow -88264623.8/9509580 -928% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(5), flask_of_alchemical_chaos_crit
3:05.093Hardent_defender
[defensives]
Fluffy_Pillow -88264623.8/9509580 -928% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(5), flask_of_alchemical_chaos_crit
3:06.383Rblessed_hammer
[standard]
Fluffy_Pillow -88264623.8/9509580 -928% HP
1.0/5 20% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(8), flask_of_alchemical_chaos_crit
3:07.671Odivine_toll
[standard]
Fluffy_Pillow -69245463.8/9509580 -728% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(9), flask_of_alchemical_chaos_crit
3:07.671Mshield_of_the_righteous
[standard]
Fluffy_Pillow -69245463.8/9509580 -728% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(9), flask_of_alchemical_chaos_crit
3:08.960Jhammer_of_light
[standard]
Fluffy_Pillow -72249025.6/9509580 -760% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(11), flask_of_alchemical_chaos_crit
3:10.248Qjudgment
[standard]
Fluffy_Pillow -73002388.1/9509580 -768% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), flask_of_alchemical_chaos_crit
3:11.396Rblessed_hammer
[standard]
Fluffy_Pillow -73002388.1/9509580 -768% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(17), flask_of_alchemical_chaos_crit
3:12.543Qjudgment
[standard]
Fluffy_Pillow -74040635.4/9509580 -779% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), flask_of_alchemical_chaos_crit
3:12.543Mshield_of_the_righteous
[standard]
Fluffy_Pillow -74040635.4/9509580 -779% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), flask_of_alchemical_chaos_crit
3:13.690Pavengers_shield
[standard]
Fluffy_Pillow -74040635.4/9509580 -779% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(21), flask_of_alchemical_chaos_crit
3:14.835Rblessed_hammer
[standard]
Fluffy_Pillow -77807615.5/9509580 -818% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_crit
3:15.981Qjudgment
[standard]
Fluffy_Pillow -76307615.5/9509580 -802% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_crit
3:17.265Rblessed_hammer
[standard]
Fluffy_Pillow -77345862.8/9509580 -813% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_crit
3:17.265Mshield_of_the_righteous
[standard]
Fluffy_Pillow -77345862.8/9509580 -813% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_crit
3:18.549Rblessed_hammer
[standard]
Fluffy_Pillow -81205684.6/9509580 -854% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(25), flask_of_alchemical_chaos_crit
3:19.834Qjudgment
[standard]
Fluffy_Pillow -81205684.6/9509580 -854% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_crit
3:21.289Rblessed_hammer
[standard]
Fluffy_Pillow -84900896.4/9509580 -893% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_crit
3:21.289Mshield_of_the_righteous
[standard]
Fluffy_Pillow -84900896.4/9509580 -893% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_crit
3:22.572Pavengers_shield
[standard]
Fluffy_Pillow -88756726.6/9509580 -933% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(29), flask_of_alchemical_chaos_crit
3:23.855Qjudgment
[standard]
Fluffy_Pillow -88756726.6/9509580 -933% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(30), flask_of_alchemical_chaos_crit
3:25.137Rblessed_hammer
[standard]
Fluffy_Pillow -91466532.6/9509580 -962% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(30), flask_of_alchemical_chaos_crit
3:26.420Qjudgment
[standard]
Fluffy_Pillow -95986361.1/9509580 -1009% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(31), flask_of_alchemical_chaos_crit
3:26.420Mshield_of_the_righteous
[standard]
Fluffy_Pillow -95986361.1/9509580 -1009% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(31), flask_of_alchemical_chaos_crit
3:27.704Sconsecration
[standard]
Fluffy_Pillow -95986361.1/9509580 -1009% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(34), flask_of_alchemical_chaos_crit
3:28.987Pavengers_shield
[standard]
Fluffy_Pillow -97024608.4/9509580 -1020% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(34), flask_of_alchemical_chaos_crit
3:30.270Ijudgment
[standard]
Fluffy_Pillow -99237612.5/9509580 -1044% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sanctification(2), lights_deliverance(35), flask_of_alchemical_chaos_crit
3:31.555Leye_of_tyr
[standard]
Fluffy_Pillow -99237612.5/9509580 -1044% HP
1.0/5 20% HoPo
redoubt(3), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_crit
3:32.839Jhammer_of_light
[standard]
Fluffy_Pillow -99237612.5/9509580 -1044% HP
4.0/5 80% HoPo
redoubt(3), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), hammer_of_light_ready, sanctification(3), lights_deliverance(35), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:32.839Mshield_of_the_righteous
[standard]
Fluffy_Pillow -97620983.5/9509580 -1027% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, sanctification(3), lights_deliverance(36), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:34.123Ijudgment
[standard]
Fluffy_Pillow -97620983.5/9509580 -1027% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:35.270Qjudgment
[standard]
Fluffy_Pillow -96120983.5/9509580 -1011% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:35.270Mshield_of_the_righteous
[standard]
Fluffy_Pillow -96120983.5/9509580 -1011% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:36.417Rblessed_hammer
[standard]
Fluffy_Pillow -96842507.1/9509580 -1018% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(44), flask_of_alchemical_chaos_crit
3:37.564Pavengers_shield
[standard]
Fluffy_Pillow -96842507.1/9509580 -1018% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_crit
3:38.710Ijudgment
[standard]
Fluffy_Pillow -97749267.0/9509580 -1028% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(45), flask_of_alchemical_chaos_crit
3:39.857Qjudgment
[standard]
Fluffy_Pillow -97749267.0/9509580 -1028% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(46), flask_of_alchemical_chaos_crit
3:39.857Mshield_of_the_righteous
[standard]
Fluffy_Pillow -97749267.0/9509580 -1028% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(46), flask_of_alchemical_chaos_crit
3:41.141Rblessed_hammer
[standard]
Fluffy_Pillow -97287514.3/9509580 -1023% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(48), flask_of_alchemical_chaos_haste
3:42.367Rblessed_hammer
[standard]
Fluffy_Pillow -98325761.6/9509580 -1034% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(49), flask_of_alchemical_chaos_haste
3:43.594Ijudgment
[standard]
Fluffy_Pillow -98325761.6/9509580 -1034% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(50), flask_of_alchemical_chaos_haste
3:43.594Mshield_of_the_righteous
[standard]
Fluffy_Pillow -98325761.6/9509580 -1034% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(50), flask_of_alchemical_chaos_haste
3:44.820Pavengers_shield
[standard]
Fluffy_Pillow -99364008.8/9509580 -1045% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(52), flask_of_alchemical_chaos_haste
3:46.046Qjudgment
[standard]
Fluffy_Pillow -97864008.8/9509580 -1029% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(53), flask_of_alchemical_chaos_haste
3:47.273Rblessed_hammer
[standard]
Fluffy_Pillow -98770768.7/9509580 -1039% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(53), flask_of_alchemical_chaos_haste
3:48.499Qjudgment
[standard]
Fluffy_Pillow -99940777.6/9509580 -1051% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(54), flask_of_alchemical_chaos_haste
3:48.602Mshield_of_the_righteous
[standard]
Fluffy_Pillow -99940777.6/9509580 -1051% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(54), flask_of_alchemical_chaos_haste
3:49.829Rblessed_hammer
[standard]
Fluffy_Pillow -99940777.6/9509580 -1051% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(57), flask_of_alchemical_chaos_haste
3:51.055Rblessed_hammer
[standard]
Fluffy_Pillow -99610786.4/9509580 -1047% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(57), flask_of_alchemical_chaos_haste
3:52.283Pavengers_shield
[standard]
Fluffy_Pillow -100780795.3/9509580 -1060% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(58), flask_of_alchemical_chaos_haste
3:53.510Ijudgment
[standard]
Fluffy_Pillow -100780795.3/9509580 -1060% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_haste
3:53.510Mshield_of_the_righteous
[standard]
Fluffy_Pillow -100780795.3/9509580 -1060% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_haste
3:54.738Jhammer_of_light
[standard]
Fluffy_Pillow -101819316.7/9509580 -1071% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, flask_of_alchemical_chaos_haste
3:55.964Odivine_toll
[standard]
Fluffy_Pillow -98702687.7/9509580 -1038% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), flask_of_alchemical_chaos_haste
3:57.060Ijudgment
[standard]
Fluffy_Pillow -99764461.9/9509580 -1049% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), flask_of_alchemical_chaos_haste
3:58.157Qjudgment
[standard]
Fluffy_Pillow -100694748.7/9509580 -1059% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), flask_of_alchemical_chaos_haste
3:58.157Mshield_of_the_righteous
[standard]
Fluffy_Pillow -100694748.7/9509580 -1059% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), flask_of_alchemical_chaos_haste
3:59.093Hardent_defender
[defensives]
Fluffy_Pillow -100694748.7/9509580 -1059% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), flask_of_alchemical_chaos_haste
3:59.252Rblessed_hammer
[standard]
Fluffy_Pillow -100694748.7/9509580 -1059% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), flask_of_alchemical_chaos_haste
4:00.349Nhammer_of_wrath
[standard]
Fluffy_Pillow -80175588.7/9509580 -843% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), flask_of_alchemical_chaos_haste
4:01.445Favenging_wrath
[cooldowns]
Fluffy_Pillow -80175588.7/9509580 -843% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(12), flask_of_alchemical_chaos_haste
4:01.552Qjudgment
[standard]
Fluffy_Pillow -80175588.7/9509580 -843% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(12), flask_of_alchemical_chaos_haste
4:01.552Mshield_of_the_righteous
[standard]
Fluffy_Pillow -80175588.7/9509580 -843% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(12), flask_of_alchemical_chaos_haste
4:02.778Rblessed_hammer
[standard]
Fluffy_Pillow -91075999.7/9509580 -958% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(14), flask_of_alchemical_chaos_haste
4:04.003Pavengers_shield
[standard]
Fluffy_Pillow -93825074.5/9509580 -987% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(15), flask_of_alchemical_chaos_haste
4:05.229Qjudgment
[standard]
Fluffy_Pillow -93386848.7/9509580 -982% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(15), flask_of_alchemical_chaos_haste
4:05.229Mshield_of_the_righteous
[standard]
Fluffy_Pillow -93386848.7/9509580 -982% HP
4.0/5 80% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(15), flask_of_alchemical_chaos_haste
4:06.456Nhammer_of_wrath
[standard]
Fluffy_Pillow -98341345.9/9509580 -1034% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(18), flask_of_alchemical_chaos_haste
4:07.683Rblessed_hammer
[standard]
Fluffy_Pillow -98341345.9/9509580 -1034% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(19), flask_of_alchemical_chaos_haste
4:07.683Mshield_of_the_righteous
[standard]
Fluffy_Pillow -98341345.9/9509580 -1034% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(19), flask_of_alchemical_chaos_haste
4:08.910Qjudgment
[standard]
Fluffy_Pillow -103491944.1/9509580 -1088% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(21), flask_of_alchemical_chaos_haste
4:10.311Rblessed_hammer
[standard]
Fluffy_Pillow -106674579.5/9509580 -1122% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_mastery
4:10.311Mshield_of_the_righteous
[standard]
Fluffy_Pillow -106674579.5/9509580 -1122% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_mastery
4:11.594Rblessed_hammer
[standard]
Fluffy_Pillow -107843548.9/9509580 -1134% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_mastery
4:12.879Leye_of_tyr
[standard]
Fluffy_Pillow -107843548.9/9509580 -1134% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_mastery
4:14.162Jhammer_of_light
[standard]
Fluffy_Pillow -109416900.8/9509580 -1151% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_ready, shake_the_heavens, sanctification(2), lights_deliverance(26), flask_of_alchemical_chaos_mastery
4:15.444Nhammer_of_wrath
[standard]
Fluffy_Pillow -107058576.5/9509580 -1126% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(32), flask_of_alchemical_chaos_mastery
4:16.591Ijudgment
[standard]
Fluffy_Pillow -110288792.7/9509580 -1160% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(32), flask_of_alchemical_chaos_mastery
4:16.591Mshield_of_the_righteous
[standard]
Fluffy_Pillow -110288792.7/9509580 -1160% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(32), flask_of_alchemical_chaos_mastery
4:17.599Mshield_of_the_righteous
[standard]
Fluffy_Pillow -111071663.9/9509580 -1168% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(35), flask_of_alchemical_chaos_mastery
4:17.737Pavengers_shield
[standard]
Fluffy_Pillow -111071663.9/9509580 -1168% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(36), flask_of_alchemical_chaos_mastery
4:18.884Qjudgment
[standard]
Fluffy_Pillow -114023069.8/9509580 -1199% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_mastery
4:18.884Mshield_of_the_righteous
[standard]
Fluffy_Pillow -114023069.8/9509580 -1199% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_mastery
4:19.943Mshield_of_the_righteous
[standard]
Fluffy_Pillow -115066898.0/9509580 -1210% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_mastery
4:20.032Rblessed_hammer
[standard]
Fluffy_Pillow -116375366.4/9509580 -1224% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(41), flask_of_alchemical_chaos_mastery
4:21.023Mshield_of_the_righteous
[standard]
Fluffy_Pillow -116375366.4/9509580 -1224% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(42), flask_of_alchemical_chaos_mastery
4:21.179Nhammer_of_wrath
[standard]
Fluffy_Pillow -117394628.2/9509580 -1234% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(43), flask_of_alchemical_chaos_mastery
4:22.559Yuse_items
[trinkets]
Fluffy_Pillow -117394628.2/9509580 -1234% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_mastery
4:22.559Qjudgment
[standard]
Fluffy_Pillow -117394628.2/9509580 -1234% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_mastery
4:22.559Mshield_of_the_righteous
[standard]
Fluffy_Pillow -117394628.2/9509580 -1234% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_mastery
4:23.843Rblessed_hammer
[standard]
Fluffy_Pillow -118413889.9/9509580 -1245% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_mastery
4:25.127Qjudgment
[standard]
Fluffy_Pillow -122000519.0/9509580 -1283% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_mastery
4:25.197Mshield_of_the_righteous
[standard]
Fluffy_Pillow -122000519.0/9509580 -1283% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(48), flask_of_alchemical_chaos_mastery
4:26.479Pavengers_shield
[standard]
Fluffy_Pillow -122000519.0/9509580 -1283% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(4), lights_deliverance(51), flask_of_alchemical_chaos_mastery
4:27.764Nhammer_of_wrath
[standard]
Fluffy_Pillow -122855024.4/9509580 -1292% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(52), flask_of_alchemical_chaos_mastery
4:29.047Qjudgment
[standard]
Fluffy_Pillow -125649065.7/9509580 -1321% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_mastery
4:29.047Mshield_of_the_righteous
[standard]
Fluffy_Pillow -125649065.7/9509580 -1321% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(52), flask_of_alchemical_chaos_mastery
4:30.330Rblessed_hammer
[standard]
Fluffy_Pillow -125342601.5/9509580 -1318% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(55), flask_of_alchemical_chaos_mastery
4:31.614Qjudgment
[standard]
Fluffy_Pillow -126511570.8/9509580 -1330% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(56), flask_of_alchemical_chaos_mastery
4:31.614Mshield_of_the_righteous
[standard]
Fluffy_Pillow -126511570.8/9509580 -1330% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(56), flask_of_alchemical_chaos_mastery
4:32.897Rblessed_hammer
[standard]
Fluffy_Pillow -126511570.8/9509580 -1330% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(58), flask_of_alchemical_chaos_mastery
4:34.180Nhammer_of_wrath
[standard]
Fluffy_Pillow -127680540.2/9509580 -1343% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_mastery
4:34.180Mshield_of_the_righteous
[standard]
Fluffy_Pillow -127680540.2/9509580 -1343% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(59), flask_of_alchemical_chaos_mastery
4:35.462Qjudgment
[standard]
Fluffy_Pillow -127374075.9/9509580 -1339% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), flask_of_alchemical_chaos_mastery
4:36.745Rblessed_hammer
[standard]
Fluffy_Pillow -127374075.9/9509580 -1339% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), flask_of_alchemical_chaos_mastery
4:38.029Rblessed_hammer
[standard]
Fluffy_Pillow -128543045.3/9509580 -1352% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(3), flask_of_alchemical_chaos_mastery
4:38.029Mshield_of_the_righteous
[standard]
Fluffy_Pillow -128543045.3/9509580 -1352% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(3), flask_of_alchemical_chaos_mastery
4:39.040Mshield_of_the_righteous
[standard]
Fluffy_Pillow -128543045.3/9509580 -1352% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(5), flask_of_alchemical_chaos_mastery
4:39.315Jhammer_of_light
[standard]
Fluffy_Pillow -129712014.6/9509580 -1364% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(8), flask_of_alchemical_chaos_mastery
4:40.118Mshield_of_the_righteous
[standard]
Fluffy_Pillow -126595385.6/9509580 -1331% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), flask_of_alchemical_chaos_mastery
4:40.600Nhammer_of_wrath
[standard]
Fluffy_Pillow -126595385.6/9509580 -1331% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(15), flask_of_alchemical_chaos_crit
4:41.750Ijudgment
[standard]
Fluffy_Pillow -127631484.4/9509580 -1342% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(16), flask_of_alchemical_chaos_crit
4:42.901Xuse_items
[trinkets]
Fluffy_Pillow -127631484.4/9509580 -1342% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(16), flask_of_alchemical_chaos_crit
4:42.901Odivine_toll
[standard]
Fluffy_Pillow -127631484.4/9509580 -1342% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(16), flask_of_alchemical_chaos_crit
4:42.901Mshield_of_the_righteous
[standard]
Fluffy_Pillow -127631484.4/9509580 -1342% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(16), flask_of_alchemical_chaos_crit
4:43.093Hardent_defender
[defensives]
Fluffy_Pillow -128427301.7/9509580 -1351% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), flask_of_alchemical_chaos_crit
4:43.954Mshield_of_the_righteous
[standard]
Fluffy_Pillow -128427301.7/9509580 -1351% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(19), flask_of_alchemical_chaos_crit
4:44.051Pavengers_shield
[standard]
Fluffy_Pillow -128427301.7/9509580 -1351% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(20), flask_of_alchemical_chaos_crit
4:45.037Mshield_of_the_righteous
[standard]
Fluffy_Pillow -126927301.7/9509580 -1335% HP
0.0/5 0% HoPo
ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(21), flask_of_alchemical_chaos_crit
4:45.201Qjudgment
[standard]
Fluffy_Pillow -107908141.7/9509580 -1135% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_crit
4:46.353Nhammer_of_wrath
[standard]
Fluffy_Pillow -107908141.7/9509580 -1135% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_crit
4:47.743Qjudgment
[standard]
Fluffy_Pillow -108835863.2/9509580 -1144% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_crit
4:47.743Mshield_of_the_righteous
[standard]
Fluffy_Pillow -108835863.2/9509580 -1144% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_crit
4:49.032Rblessed_hammer
[standard]
Fluffy_Pillow -108835863.2/9509580 -1144% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_crit
4:50.319Rblessed_hammer
[standard]
Fluffy_Pillow -108371962.0/9509580 -1140% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(28), flask_of_alchemical_chaos_crit
4:51.609Qjudgment
[standard]
Fluffy_Pillow -109408060.7/9509580 -1151% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_crit
4:51.609Mshield_of_the_righteous
[standard]
Fluffy_Pillow -109408060.7/9509580 -1151% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(29), flask_of_alchemical_chaos_crit
4:52.897Nhammer_of_wrath
[standard]
Fluffy_Pillow -109408060.7/9509580 -1151% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_crit
4:54.184Leye_of_tyr
[standard]
Fluffy_Pillow -110444159.5/9509580 -1161% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), shake_the_heavens, sanctification(3), lights_deliverance(32), flask_of_alchemical_chaos_crit
4:55.471Jhammer_of_light
[standard]
Fluffy_Pillow -108944159.5/9509580 -1146% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), hammer_of_light_ready, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, flask_of_alchemical_chaos_crit
4:56.757Pavengers_shield
[standard]
Fluffy_Pillow -107327530.5/9509580 -1129% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(38), sacrosanct_crusade, flask_of_alchemical_chaos_crit
4:57.907Qjudgment
[standard]
Fluffy_Pillow -107327530.5/9509580 -1129% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(39), sacrosanct_crusade, flask_of_alchemical_chaos_crit
4:59.058Elights_judgment
[cooldowns]
Fluffy_Pillow -107327530.5/9509580 -1129% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(39), sacrosanct_crusade, flask_of_alchemical_chaos_crit
5:00.210Nhammer_of_wrath
[standard]
Fluffy_Pillow -106373747.7/9509580 -1119% HP
2.0/5 40% HoPo
redoubt(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_crit
5:00.210Mshield_of_the_righteous
[standard]
Fluffy_Pillow -106373747.7/9509580 -1119% HP
3.0/5 60% HoPo
redoubt(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (lightforged_draenei) Raid-Buffed Unbuffed Gear Amount
Strength176470538335260832938 (30932)
Agility6176-1617561750
Stamina864521448565427205198066
Intellect17647018176176470
Spirit00000
Health897130085441000
Holy Power550
Spell Power18176685710
Crit25.65%16.51%5258
Haste13.42%12.97%8558
Versatility14.27%10.52%8202
Mitigation Versatility7.13%5.26%8202
Attack Power68717626810
Mastery21.57%19.15%5003
Armor12124912124980962
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry23.50%17.45%5258
Tank-Block47.85%46.06%0
Tank-Crit-6.00%-6.00%0

Gear

Source Slot Average Item Level: 627.00
Local Head Junkreaver's Scrapgaze
ilevel: 639, stats: { 7,364 Armor, +24,202 Sta, +752 Haste, +1,272 Vers, +3,794 StrInt }
Local Neck Enkindled Locket
ilevel: 610, stats: { +9,112 Sta, +2,870 Haste, +2,030 Mastery }
Local Shoulders Junkreaver's Shoulderplates
ilevel: 652, stats: { 7,325 Armor, +21,536 Sta, +631 Crit, +976 Haste, +3,212 StrInt }
Local Chest Aureate Sentry's Encasement
ilevel: 629, stats: { 9,241 Armor, +21,159 Sta, +649 Haste, +1,283 Mastery, +3,457 StrInt }
Local Waist Stalwart Girdle of the Fireflash (stalwart_girdle)
ilevel: 603, stats: { 4,482 Armor, +10,984 Sta, +2,035 StrInt, +544 Crit, +726 Haste }
Local Legs Sedimentary Legguards of the Aurora (sedimentary_legguards)
ilevel: 600, stats: { 6,860 Armor, +14,000 Sta, +2,638 StrInt, +833 Haste, +833 Vers }
Local Feet Secret-Dredger's Sabatons
ilevel: 606, stats: { 5,062 Armor, +11,469 Sta, +729 Haste, +563 Mastery, +2,093 StrInt }
Local Wrists Armguards of Dimming Fluorescence
ilevel: 606, stats: { 4,050 Armor, +8,601 Sta, +422 Haste, +546 Vers, +1,569 StrInt }
Local Hands Sedimentary Gauntlets of the Quickblade (sedimentary_gauntlets)
ilevel: 626, stats: { 5,106 Armor, +15,226 Sta, +2,521 StrInt, +918 Crit, +510 Vers }
Local Finger1 Dumpsterdelver's Loop
ilevel: 649, stats: { +15,523 Sta, +1,966 Crit, +4,588 Vers }
Local Finger2 Cyrce's Circlet
ilevel: 649, stats: { +15,523 Sta }, singing citrines: { Stormbringer's Runed Citrine, Undersea Overseer's Citrine, Windsinger's Runed Citrine }
item effects: { equip: Cyrce's Circlet }
Local Trinket1 Ratfang Toxin
ilevel: 645, stats: { +3,815 StrAgiInt }
item effects: { equip: Ratfang Toxin, use: Ratfang Toxin }
Local Trinket2 Garbagemancer's Last Resort
ilevel: 649, stats: { +3,959 StrAgiInt }
item effects: { use: Garbagemancer's Last Resort, equip: Garbagemancer's Last Resort }
Local Back Gem-Woven Cloak of the Quickblade (gemwoven_cloak)
ilevel: 623, stats: { 1,610 Armor, +10,948 Sta, +1,839 StrAgiInt, +603 Crit, +453 Vers }
Local Main Hand Earthen Scallywag's Gavel
ilevel: 597, weapon: { 1,658 - 2,134, 2.6 }, stats: { +1,283 Int, +6,188 Int, +6,685 Sta, +369 Haste, +451 Mastery }, temporary_enchant: Algari Mana Oil
Local Off Hand Biker Gang's Spare Tire
ilevel: 645, stats: { 29,862 Armor, +2,006 Str, +6,154 Int, +13,098 Sta, +364 Crit, +676 Mastery }

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Protection Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Araylini"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/araylini"
spec=protection
level=80
race=lightforged_draenei
role=tank
position=front
talents=CIEAN/WrsXv0CO5mzTm8Icl8KsNzMDz2YZMjZM2mZmZmxYYAAAGAAAAAAASmZWMMDGzY2aDAGDYAMYbAAAmZabWmtZACsZgBgZGGGD

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3,if=!(talent.rite_of_adjuration.enabled|talent.rite_of_sanctification.enabled)

head=junkreavers_scrapgaze,id=235458,bonus_id=11978/43/12176/11964/3322/10255
neck=enkindled_locket,id=219184,bonus_id=6652/10395/10393/10269/3189/10255
shoulders=junkreavers_shoulderplates,id=235461,bonus_id=6652/11964/11986/9460/10255
back=gemwoven_cloak,id=224664,bonus_id=11969/6652/11964/1678/3152/10255
chest=aureate_sentrys_encasement,id=229247,bonus_id=11958/6652/12178/11971/1478/10255
wrists=armguards_of_dimming_fluorescence,id=223311,bonus_id=10377/10876/10270/3135/10255
hands=sedimentary_gauntlets,id=224692,bonus_id=11970/6652/11964/1677/3155/10255
waist=stalwart_girdle,id=224622,bonus_id=11944/6652/12176/1694/10844/1530/10254
legs=sedimentary_legguards,id=224694,bonus_id=6652/1707/10377/10276/1672/10255
feet=secretdredgers_sabatons,id=211031,bonus_id=6652/10377/10270/3185/10255
finger1=dumpsterdelvers_loop,id=235425,bonus_id=11985/6652/10394/10392/9457/10255
finger2=cyrces_circlet,id=228411,bonus_id=12025/1502,gem_id=228638/228636/228640/0
trinket1=ratfang_toxin,id=235359,bonus_id=6652/11980/1517/10255
trinket2=garbagemancers_last_resort,id=235984,bonus_id=11985/6652/3328/10255
main_hand=earthen_scallywags_gavel,id=229178,bonus_id=11215/6652/10277/1459/10255
off_hand=biker_gangs_spare_tire,id=235494,bonus_id=6652/11980/3328/10255

# Gear Summary
# gear_ilvl=626.75
# gear_strength=32938
# gear_stamina=198066
# gear_crit_rating=5258
# gear_haste_rating=8558
# gear_mastery_rating=5003
# gear_versatility_rating=8202
# gear_armor=80962

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 86218961
Max Event Queue: 115
Sim Seconds: 3006778
CPU Seconds: 92.7240
Physical Seconds: 38.8127
Speed Up: 32427

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Araylini Araylini ardent_defender 31850 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 49.24sec 0 299.99sec
Araylini Araylini augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini avengers_shield 31935 9058329 30196 5.68 241768 510139 28.4 28.4 28.8% 0.0% 0.0% 0.0% 10.51sec 9058329 299.99sec
Araylini Araylini tyrs_enforceravengers_shield 378286 965548 3219 5.68 25791 54454 28.4 28.4 28.6% 0.0% 0.0% 0.0% 10.51sec 965548 299.99sec
Araylini Araylini avenging_wrath 454351 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 82.59sec 0 299.99sec
Araylini Araylini blessed_hammer 204019 0 0 0.00 0 0 68.0 0.0 0.0% 0.0% 0.0% 0.0% 4.28sec 0 299.99sec
Araylini Araylini blessed_hammer_tick ticks -204301 4568479 15228 0.00 25813 54489 0.0 0.0 27.4% 0.0% 0.0% 0.0% 0.00sec 4568479 299.99sec
Araylini Araylini blessed_hammer_absorb 0 2551854 8507 21.26 24002 0 0.0 106.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini bulwark_of_order_absorb 0 6750577 22503 6.91 195371 0 0.0 34.6 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini consecration 26573 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 33.09sec 0 299.99sec
Araylini Araylini consecration_tick ticks -81297 1649494 5498 0.00 9518 20073 0.0 0.0 27.6% 0.0% 0.0% 0.0% 0.00sec 1649494 299.99sec
Araylini Araylini devotion_aura 465 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini divine_toll 375576 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.71sec 0 299.99sec
Araylini Araylini avengers_shield_dt 31935 2224293 7415 1.39 241823 508653 7.0 7.0 29.0% 0.0% 0.0% 0.0% 45.71sec 2224293 299.99sec
Araylini Araylini tyrs_enforceravengers_shield_dt 378286 237473 792 1.39 25830 54563 7.0 7.0 28.7% 0.0% 0.0% 0.0% 45.71sec 237473 299.99sec
Araylini Araylini empyrean_hammer 431398 50557248 168531 78.76 96747 204367 393.8 393.8 29.4% 0.0% 0.0% 0.0% 0.77sec 50557248 299.99sec
Araylini Araylini eye_for_an_eye 469311 928009 3093 2.22 60590 127371 11.1 11.1 34.3% 0.0% 0.0% 0.0% 29.87sec 928009 299.99sec
Araylini Araylini eye_of_tyr 387174 4274650 14249 1.53 418339 874931 7.7 7.7 30.4% 0.0% 0.0% 0.0% 41.76sec 4274650 299.99sec
Araylini Araylini flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini garbagemancers_last_resort 1219294 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.63sec 0 299.99sec
Araylini Araylini garbocalypse 1219299 6498986 21664 0.56 1743661 3531041 2.8 2.8 32.7% 0.0% 0.0% 0.0% 120.63sec 9284256 299.99sec
Araylini Araylini hammer_of_light 427453 23833011 79447 2.71 1345334 2784414 13.5 13.5 28.8% 0.0% 0.0% 0.0% 22.95sec 23833011 299.99sec
Araylini Araylini hammer_of_light_consecration 26573 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 22.96sec 0 299.99sec
Araylini Araylini hammer_of_light_consecration_tick ticks -81297 3074271 10248 0.00 9566 20116 0.0 0.0 28.0% 0.0% 0.0% 0.0% 0.00sec 3074271 299.99sec
Araylini Araylini hammer_of_wrath 24275 14317995 47729 5.87 352780 727159 29.4 29.3 36.1% 0.0% 0.0% 0.0% 10.33sec 14317995 299.99sec
Araylini Araylini holy_shield 157122 988104 3294 8.18 18117 38319 40.9 40.9 29.9% 0.0% 0.0% 0.0% 7.23sec 988104 299.99sec
Araylini Araylini judgment 275779 33413594 111383 17.67 285772 603065 88.4 88.3 29.2% 0.0% 0.0% 0.0% 3.41sec 33413594 299.99sec
Araylini Araylini lights_judgment 255647 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 150.40sec 0 299.99sec
Araylini Araylini lights_judgment_damage 256893 1329511 4432 0.50 411225 831424 2.5 2.5 29.6% 0.0% 0.0% 0.0% 150.39sec 1329511 299.99sec
Araylini Araylini melee 0 7726274 25755 36.20 32302 68112 181.0 181.0 29.0% 0.0% 0.0% 0.0% 1.98sec 11037523 299.99sec
Araylini Araylini potion 431932 0 0 0.00 0 0 1.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini ratfang_toxin ticks -1216606 6257081 20857 5.31 175159 339687 3.6 26.5 36.8% 0.0% 0.0% 0.0% 94.70sec 6257081 299.99sec
Araylini Araylini refining_fire ticks -469882 5580633 18602 44.43 18985 40357 35.4 222.2 28.7% 0.0% 0.0% 0.0% 8.44sec 5580633 299.99sec
Araylini Araylini sacrosanct_crusade_absorb 0 14091905 46975 3.05 923188 0 0.0 15.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Araylini Araylini sacrosanct_crusade_heal 461885 20272938 67579 2.71 1497217 0 13.5 13.5 0.0% 0.0% 0.0% 0.0% 22.95sec 21798059 299.99sec
Araylini Araylini shield_of_the_righteous 53600 16996733 56658 19.30 132346 272818 96.5 96.5 31.2% 0.0% 0.0% 0.0% 3.11sec 16996733 299.99sec
Araylini Araylini undersea_overseers_citrine 462953 5373491 17912 5.76 144534 290309 28.8 28.8 28.9% 0.0% 0.0% 0.0% 10.16sec 5373491 299.99sec
Araylini Araylini word_of_glory 85673 16395751 54655 0.91 3004414 6043153 4.5 4.5 20.0% 0.0% 0.0% 0.0% 35.11sec 16395751 299.99sec

Fluffy_Pillow : 1,258,448 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,258,447.91,258,447.90.0 / 0.000%0.0 / 0.0%1.9
Resource Out In Waiting APM Active
Health654,486.30.046.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow1,258,448
melee_main_hand_Araylini 690,50654.9%77.53.75s2,674,3051,337,153Direct77.53,172,79902,674,2700.0%15.7%48.8%

Stats Details: Melee Main Hand Araylini

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.5077.500.000.000.002.00000.0000207,250,738.67914,479,021.1777.34%1,337,153.301,337,153.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit35.46%27.4810453,921,442.0307,159,4203,917,890.842,876,1664,573,122107,757,132384,689,33572.01%
hit (blocked)48.83%37.8418612,629,196.0604,664,0732,627,314.602,107,2622,952,16799,493,607529,789,68681.23%
parry15.71%12.181280.00000.0000000.00%

Action Details: Melee Main Hand Araylini

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13720000.00
  • base_dd_max:14280000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Araylini 114,0149.0%5.559.57s6,240,1103,113,189Direct5.56,239,72806,239,7280.0%0.0%56.5%

Stats Details: Melee Nuke Araylini

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000034,104,988.54153,033,059.9177.71%3,113,189.283,113,189.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit43.48%2.38067,617,229.81013,796,5957,248,311.53011,884,91318,102,62766,545,17669.65%
hit (blocked)56.52%3.09065,180,316.3409,222,1175,132,591.5207,916,29716,002,36286,487,88480.66%

Action Details: Melee Nuke Araylini

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27440000.00
  • base_dd_max:28560000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Araylini 453,92836.1%5.361.01s25,491,74625,378,801Periodic144.8940,1380940,1380.0%0.0%0.0%96.5%

Stats Details: Spell Dot Araylini

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.80144.800.001.00452.0000136,131,888.87202,715,071.5132.85%461,531.3025,378,801.06
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.80115174940,138.3701,263,654940,698.23882,211998,273136,131,889202,715,07232.81%

Action Details: Spell Dot Araylini

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1400000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Araylini
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1500000.00
  • base_dd_max:1500000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessed Hammer106.629.02.7s2.1s1.0s33.99%49.54%29.0 (29.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_blessed_hammer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 26.6s
  • trigger_min/max:0.0s / 25.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:27.09% / 41.08%

Stack Uptimes

  • blessed_hammer_1:33.99%

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Eye of Tyr7.70.041.7s41.7s5.9s15.19%13.64%0.0 (0.0)7.5

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_eye_of_tyr
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 61.3s
  • trigger_min/max:40.2s / 61.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:13.71% / 16.71%

Stack Uptimes

  • eye_of_tyr_1:15.19%

Spelldata

  • id:387174
  • name:Eye of Tyr
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment88.30.05.3s3.4s3.3s69.58%69.13%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 31.5s
  • trigger_min/max:0.8s / 9.2s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 28.1s
  • uptime_min/max:52.85% / 82.96%

Stack Uptimes

  • judgment_1:52.97%
  • judgment_2:14.85%
  • judgment_3:1.70%
  • judgment_4:0.06%
  • judgment_5:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ratfang Toxin (_debuff)3.614.693.0s16.2s82.2s100.00%72.06%0.0 (0.0)0.0

Buff Details

  • buff initial source:Araylini
  • cooldown name:buff_ratfang_toxin_debuff
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 104.0s
  • trigger_min/max:0.0s / 103.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • ratfang_toxin_debuff_1:0.01%
  • ratfang_toxin_debuff_2:0.35%
  • ratfang_toxin_debuff_3:0.24%
  • ratfang_toxin_debuff_4:0.18%
  • ratfang_toxin_debuff_5:99.23%

Spelldata

  • id:1216604
  • name:Ratfang Toxin
  • tooltip:Your harmful spells and abilities apply Ratfang Toxin to your target.
  • description:{$@spelldesc1216603=Your harmful spells and abilities apply Ratfang Toxin to your target, stacking up to {$s1=5} times.}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 1258447.92
Minimum 1076418.53
Maximum 1452970.69
Spread ( max - min ) 376552.16
Range [ ( max - min ) / 2 * 100% ] 14.96%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 1258447.92
Minimum 1076418.53
Maximum 1452970.69
Spread ( max - min ) 376552.16
Range [ ( max - min ) / 2 * 100% ] 14.96%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 377487616.08
Minimum 262922376.32
Maximum 480730182.45
Spread ( max - min ) 217807806.13
Range [ ( max - min ) / 2 * 100% ] 28.85%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 666633.06
Minimum 598533.61
Maximum 744674.43
Spread ( max - min ) 146140.82
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 20084.0483
5th Percentile 632647.38
95th Percentile 699839.63
( 95th Percentile - 5th Percentile ) 67192.25
Mean Distribution
Standard Deviation 200.8505
95.00% Confidence Interval ( 666239.40 - 667026.72 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3487
0.1 Scale Factor Error with Delta=300 3443390
0.05 Scale Factor Error with Delta=300 13773560
0.01 Scale Factor Error with Delta=300 344338977
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=14000000,range=280000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=28000000,range=560000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=1400000,range=28000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health02311778850
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=14000000,range=280000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=28000000,range=560000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=1400000,range=28000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.