SimulationCraft 1125-01      berechnet von Metaux@Antonidas

for World of Warcraft 11.2.5.63660 Live (hotfix 2025-10-07/63660, git build 55426d8a41)

Current simulator hotfixes

Demon Hunter

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
213243Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
178963Consume Soul prj_speed 25.00 0.00

Druid

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
Balance Druid aura does not increase Regrowth cost
260777Balance Druid (effect#6) base_value 0.00 47.00

Evoker

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
1035393Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-06-28 Manually set Arcane Orb's travel speed.
153626Arcane Orb prj_speed 30.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
30455Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
84714Frozen Orb prj_speed 20.00 0.00

Monk

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#2).
1233895Monk Shado-Pan 11.2 Class Set 4pc (effect#2) base_value 120.00 150.00
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#1).
1232299Monk Shado-Pan 11.2 Class Set 4pc (effect#1) base_value 100.00 50.00
2025-08-03 Manually revert TWW3-SPM-2p hotfixes (effect#3).
1233833Monk Shado-Pan 11.2 Class Set 2pc (effect#3) base_value 100.00 70.00

Rogue

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-07-29 Fatebound Lucky Coin Expiry
1156957Fateful Ending (effect#2) base_value 15.00 10.00

Shaman

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
191634Stormkeeper max_stack 3.00 0.00

Lycrow : 1,027,248 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,027,248.21,027,248.2467.6 / 0.046%93,886.1 / 9.1%30,712.5
Resource Out In Waiting APM Active
Energy33.433.24.29%62.9100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/lycrow
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAMAAAAAAAzyMzsMZwMjZmxYGmZGzMjZbWGGbbzMjZYwYmlZbAAAAYGMsY2mxsNDjFGWmZbahWmFmZA
Scale Factors for Lycrow Damage Per Second
Wdps Agi Vers Mastery Crit Haste
Scale Factors 87.19 15.50 11.97 8.60 8.34 7.67
Normalized 5.62 1.00 0.77 0.55 0.54 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.31 0.29 0.29 0.29 0.29 0.29
Ranking
  • Wdps > Agi > Vers > Mastery ~= Crit > Haste
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, Agility=15.50, CritRating=8.34, HasteRating=7.67, MasteryRating=8.60, Versatility=11.97, Dps=87.19 )

Scale Factors for other metrics

Scale Factors for Lycrow Priority Target Damage Per Second
Wdps Agi Vers Mastery Crit Haste
Scale Factors 87.19 15.50 11.97 8.60 8.34 7.67
Normalized 5.62 1.00 0.77 0.55 0.54 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.31 0.29 0.29 0.29 0.29 0.29
Ranking
  • Wdps > Agi > Vers > Mastery ~= Crit > Haste
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, Agility=15.50, CritRating=8.34, HasteRating=7.67, MasteryRating=8.60, Versatility=11.97, Dps=87.19 )
Scale Factors for Lycrow Damage Per Second (Effective)
Wdps Agi Vers Mastery Crit Haste
Scale Factors 87.19 15.50 11.97 8.60 8.34 7.67
Normalized 5.62 1.00 0.77 0.55 0.54 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, Agility=15.50, CritRating=8.34, HasteRating=7.67, MasteryRating=8.60, Versatility=11.97, Dps=87.19 )
Scale Factors for Lycrow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, )
Scale Factors for Lycrow Fight Length
Agi Haste Mastery Crit Wdps Vers
Scale Factors 0.00 0.00 -0.00 -0.00 -0.00 -0.00
Normalized 1.00 0.97 -0.00 -0.97 -0.97 -1.92
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Agi > Haste > Mastery > Crit > Wdps > Vers
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, Agility=0.00, CritRating=-0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=-0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Agi Vers Mastery Crit Haste
Scale Factors 87.19 15.50 11.97 8.60 8.34 7.67
Normalized 5.62 1.00 0.77 0.55 0.54 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.31 0.29 0.29 0.29 0.29 0.29
Ranking
  • Wdps > Agi > Vers > Mastery ~= Crit > Haste
Pawn string ( Pawn: v1: "Lycrow-Subtlety": Class=Rogue, Spec=Subtlety, Agility=15.50, CritRating=8.34, HasteRating=7.67, MasteryRating=8.60, Versatility=11.97, Dps=87.19 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval Total Time DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Lycrow1,027,248
Auto Attack 0 (153,821)0.0% (15.0%)4.678.94s0.0s10,006,9350

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.610.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 42,2844.1%326.91.07s0.0s38,78436,551Direct326.933,45767,17638,78432.0%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage326.91326.910.000.000.001.06110.000012,678,751.2816,493,578.9923.13%36,550.6236,550.62
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit51.67%168.9110524233,457.2322,47646,27833,468.2631,76135,4175,651,4467,351,99623.13%
crit32.00%104.616316067,175.9944,95292,55667,202.6862,85772,9227,027,3059,141,58323.13%
miss16.33%53.3824850.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 19,0011.9%326.31.07s0.0s17,46316,451Direct326.315,06530,26417,46232.0%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage326.26326.260.000.000.001.06150.00005,697,513.637,411,800.0323.13%16,451.3016,451.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit51.67%168.5811123815,064.7810,12120,83815,069.3614,27316,0402,539,6153,303,80123.13%
crit31.98%104.346016030,263.7220,24141,67730,276.3328,12832,8083,157,8994,107,99923.13%
miss16.35%53.3427870.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Hunt Them Down 92,5369.0%434.20.83s0.0s63,9130Direct434.248,31396,98863,91232.0%0.0%

Stats Details: Hunt Them Down

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage434.16434.160.000.000.000.00000.000027,748,308.8427,748,308.840.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.95%295.0219039348,312.5136,32866,83048,349.9846,21051,44414,253,22614,253,2260.00%
crit32.05%139.147421396,987.9772,656133,66197,071.3990,538105,05313,495,08313,495,0830.00%

Action Details: Hunt Them Down

  • id:457193
  • school:shadowstorm
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457193
  • name:Hunt Them Down
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457054=Auto-attacks against Marked targets deal an additional {$457193s1=0} Plague damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703512PCT45.0%
Spell Periodic AmountSubtlety Rogue13703513PCT45.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountVeiltouched3820175PCT5.0%
Spell Direct AmountVeiltouched3820176PCT5.0%
Deathstalker's Mark 86,9878.5%79.93.73s0.0s326,0950Direct79.9246,436494,224326,09232.1%0.0%

Stats Details: Deathstalkers Mark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage79.9479.940.000.000.000.00000.000026,069,278.8726,069,278.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.85%54.243277246,435.71174,374320,785246,452.55230,782266,68713,367,63113,367,6310.00%
crit32.15%25.70943494,223.97348,749641,570494,400.38432,930576,29412,701,64812,701,6480.00%

Action Details: Deathstalkers Mark

  • id:457157
  • school:shadowstorm
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457157
  • name:Deathstalker's Mark
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703512PCT45.0%
Spell Periodic AmountSubtlety Rogue13703513PCT45.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountVeiltouched3820175PCT5.0%
Spell Direct AmountVeiltouched3820176PCT5.0%
Eviscerate 209,214 (282,544)20.4% (27.5%)85.63.40s85.9s / 28.6%990,198985,773Direct85.6391,4011,037,723733,21052.9%0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.5585.550.000.000.001.00450.000062,728,571.1581,561,413.5023.09%985,773.25985,773.25
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit47.11%40.302359391,400.85179,965759,285391,319.32313,630475,79615,773,99820,508,77823.09%
crit52.89%45.2527691,037,722.96359,9312,417,1401,039,405.80900,8881,195,68046,954,57361,052,63623.09%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=false}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=false}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [Q]:85.56
  • if_expr:cooldown.flagellation.remains>=10|variable.targets>=3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 73,3297.1%85.33.41s0.0s257,7930Direct85.3170,162336,138257,79952.8%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.2985.290.000.000.000.00000.000021,986,810.3921,986,810.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit47.20%40.252361170,161.9785,797329,405170,138.68138,412204,0606,849,2836,849,2830.00%
crit52.80%45.042568336,137.61171,594658,810336,109.89286,786392,83815,137,52715,137,5270.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=false}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=false}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Fatal Intent 6,3800.6%1.00.00s0.0s1,907,4140Direct1.01,456,4702,900,8271,906,65231.2%0.0%

Stats Details: Fatal Intent

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.001.000.000.000.000.00000.00001,907,414.281,907,414.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.82%0.69011,456,469.91758,5282,981,6211,002,532.0202,981,6211,002,5321,002,5320.00%
crit31.18%0.31012,900,826.771,644,0335,537,863904,882.2605,537,863904,882904,8820.00%

Action Details: Fatal Intent

  • id:461984
  • school:shadowstorm
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461984
  • name:Fatal Intent
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703512PCT45.0%
Spell Periodic AmountSubtlety Rogue13703513PCT45.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountVeiltouched3820175PCT5.0%
Spell Direct AmountVeiltouched3820176PCT5.0%
Flagellation 1,030 (12,681)0.1% (1.2%)3.791.63s3.7s / 1.2%1,028,2411,023,750Direct3.762,888125,93683,32432.4%0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.703.700.000.000.001.00450.0000308,302.11308,302.110.00%1,023,749.871,023,749.87
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.58%2.500462,888.2660,12994,72561,766.99094,725157,246157,2460.00%
crit32.42%1.2004125,935.99120,258189,45095,946.960189,450151,056151,0560.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=10}/10*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [N]:3.70
  • if_expr:combo_points>=5&cooldown.shadow_blades.remains<=3|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 11,6511.1%0.00.00s0.0s00Direct23.9110,222220,541146,01832.4%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.940.000.000.000.00000.00003,495,952.413,495,952.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.55%16.17527110,222.3172,756133,845110,175.6197,390124,1111,782,6781,782,6780.00%
crit32.45%7.77018220,540.87145,512267,690220,562.020267,6901,713,2741,713,2740.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=10}/10*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Gloomblade 74,0317.2%100.22.92s100.7s / 33.6%221,614220,624Direct100.2108,785302,869221,61858.1%0.0%

Stats Details: Gloomblade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage100.20100.200.000.000.001.00450.000022,206,199.0722,206,199.070.00%220,623.53220,623.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit41.86%41.952170108,784.8779,246262,915108,800.0695,253124,3804,563,6384,563,6380.00%
crit58.14%58.253290302,868.62174,341734,549303,622.33270,539360,10717,642,56117,642,5610.00%

Action Details: Gloomblade

  • id:200758
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:200758
  • name:Gloomblade
  • school:shadow
  • tooltip:
  • description:Punctures your target with your shadow-infused blade for {$s1=0} Shadow damage, bypassing armor.{$?s319949=true}[ Critical strikes apply Find Weakness for {$319949s1=10} sec.][] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:15.14
  • if_expr:buff.shadow_dance.up&!used_for_danse|!variable.stealth&buff.shadow_blades.up
    build
    [H]:85.06

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 10,8421.1%0.00.00s0.0s00Direct266.19,22918,53012,21232.1%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00266.140.000.000.000.00000.00003,250,228.523,250,228.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.93%180.781112569,229.067,41612,6329,230.888,7049,8651,668,4451,668,4450.00%
crit32.07%85.364613818,530.4614,83225,26418,537.5616,96020,2191,581,7841,581,7840.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 62,686 (115,797)6.1% (11.3%)10.627.95s10.7s / 3.6%3,267,0053,252,426Periodic166.884,810171,588112,62632.1%0.0%97.2%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.630.00166.84166.848.291.00451.748718,790,350.4818,790,350.480.00%114,803.793,252,426.31
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.94%113.357315884,810.4890194,61684,853.4474,55194,6159,613,4929,613,4920.00%
crit32.06%53.482786171,588.0164389,233171,760.53129,413214,9099,176,8599,176,8590.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.336574
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.27
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=false}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=false}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [P]:10.63
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable|buff.flagellation_buff.up&!buff.symbols_of_death.up&variable.targets<=2)&target.time_to_die-remains>6&cooldown.flagellation.remains>=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 13,2301.3%166.81.77s0.0s23,7710Periodic166.817,88836,25823,77132.0%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage166.840.000.00166.840.000.00000.00003,965,947.163,965,947.160.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.97%113.407515617,887.8810,10541,21617,897.2615,64219,9942,028,4852,028,4850.00%
crit32.03%53.43248436,258.2820,21082,43236,296.5128,19144,9391,937,4621,937,4620.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Corrupt the Blood 39,8803.9%177.51.67s0.0s67,4130Periodic177.551,046102,12567,41232.0%0.0%0.0%

Stats Details: Corrupt The Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage177.460.000.00177.460.000.00000.000011,963,353.2411,963,353.240.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.96%120.608016551,046.253,93373,51351,046.2847,78453,6886,156,4186,156,4180.00%
crit32.04%56.862886102,124.537,866147,027102,119.9091,458114,0095,806,9355,806,9350.00%

Action Details: Corrupt The Blood

  • id:457133
  • school:shadowstorm
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • school:shadowstorm
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703512PCT45.0%
Spell Periodic AmountSubtlety Rogue13703513PCT45.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountVeiltouched3820175PCT5.0%
Spell Direct AmountVeiltouched3820176PCT5.0%
Secret Technique 0 (72,345)0.0% (7.0%)9.931.50s10.0s / 3.3%2,183,3412,173,665

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.910.000.000.000.001.00450.00000.000.000.00%2,173,665.142,173,665.14

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=false}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=false}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [O]:9.91
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Secret Technique (_player) 17,5481.7%0.00.00s0.0s00Direct9.9317,367690,221529,61656.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.009.910.000.000.000.00000.00005,247,708.386,822,640.5623.08%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit43.07%4.2708317,366.73177,806413,357317,764.760413,3571,354,4931,760,92623.06%
crit56.93%5.64311690,221.00389,5361,013,616692,585.64543,348884,2533,893,2165,061,71523.09%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=false}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=false}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Secret Technique (_clones) 54,7965.3%0.00.00s0.0s00Direct19.8489,4211,086,591829,34656.9%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0019.760.000.000.000.00000.000016,386,780.8016,386,780.800.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit43.07%8.51116489,420.69287,791642,981490,492.40402,892611,2114,165,4314,165,4310.00%
crit56.93%11.256201,086,590.86575,5821,612,3901,089,097.60919,1801,377,57412,221,35012,221,3500.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=false}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=false}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Shadow Blades 0 (67,572)0.0% (6.6%)3.791.29s0.0s5,535,6750

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.660.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [L]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 67,5726.6%373.61.26s0.0s54,2410Periodic373.654,241054,2410.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage373.640.000.00373.640.000.00000.000020,267,024.5120,267,024.510.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%373.6427546354,241.14147548,20754,270.8745,26163,83620,267,02520,267,0250.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6303.10
  • base_dd_max:6303.10
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 92,0429.0%48.66.30s48.8s / 16.3%567,548565,009Direct48.6310,479810,204567,53451.4%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage48.5648.560.000.000.001.00450.000027,559,443.9235,858,994.6423.14%565,009.00565,009.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.56%23.581038310,479.08123,615451,203310,553.16246,932372,8147,321,2049,531,42123.19%
crit51.44%24.981141810,203.67298,8491,335,165811,338.03654,331968,84020,238,24026,327,57323.13%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:25.84
  • if_expr:debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
    build
    [G]:22.72

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Shuriken Storm 1,815 (9,144)0.2% (0.9%)10.424.30s10.4s / 3.5%264,822263,656Direct10.431,54671,03252,61553.4%0.0%

Stats Details: Shuriken Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.3710.370.000.000.001.00450.0000545,349.60709,922.5223.18%263,656.35263,656.35
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit46.65%4.8401331,545.6627,68855,65231,422.93051,238152,533198,58923.10%
crit53.35%5.5301471,032.2260,914142,93970,819.350118,179392,817511,33423.16%

Action Details: Shuriken Storm

  • id:197835
  • school:physical
  • range:0.0
  • travel_speed:35.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:per_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Spelldata

  • id:197835
  • name:Shuriken Storm
  • school:physical
  • tooltip:
  • description:Sprays shurikens at all enemies within {$=}A1 yards, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} Physical damage{$?a277953=false}[ and reducing movement speed by {$206760s1=50}% for {$206760d=8 seconds}]?a428387[ and increasing movement speed by {$428389s1=30}% for {$428389d=3 seconds} when striking {$428387s1=3} or more enemies][]. Deals reduced damage beyond {$s4=8} targets.{$?s319951=true}[ Critical strikes with Shuriken Storm apply Find Weakness for {$319949s1=10} sec.][] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points; per target hit.|r

Action Priority List

    build
    [F]:10.37
  • if_expr:buff.clear_the_witnesses.up&(variable.targets>=2|!buff.symbols_of_death.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Shuriken Storm3199512ADD0.150
    Clear the Witnesses 7,3280.7%10.424.30s0.0s212,2490Direct10.4161,304322,662212,24531.6%0.0%

Stats Details: Clear The Witnesses

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.3710.370.000.000.000.00000.00002,201,685.912,201,685.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.43%7.10115161,303.71145,312219,475161,297.93153,241194,4001,144,9851,144,9850.00%
crit31.57%3.27012322,662.03290,624438,951314,834.200426,2631,056,7011,056,7010.00%

Action Details: Clear The Witnesses

  • id:457179
  • school:shadowstorm
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457179
  • name:Clear the Witnesses
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457053=Your next {$?=}c1[Fan of Knives][Shuriken Storm] after applying Deathstalker's Mark deals an additional {$457179s1=0} Plague damage and generates {$457178s1=1} additional combo point.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSubtlety Rogue1370351PCT10.0%
Spell Periodic AmountSubtlety Rogue1370352PCT10.0%
Spell Direct AmountSubtlety Rogue13703512PCT45.0%
Spell Periodic AmountSubtlety Rogue13703513PCT45.0%
Spell Direct AmountSubtlety Rogue13703514PCT10.0%
Spell Periodic AmountSubtlety Rogue13703515PCT10.0%
Spell Periodic AmountVeiltouched3820175PCT5.0%
Spell Direct AmountVeiltouched3820176PCT5.0%
Sikran's Endless Arsenal 0 (17,338)0.0% (1.7%)5.560.43s0.0s947,9750

Stats Details: Sikrans Endless Arsenal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.470.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sikrans Endless Arsenal

  • id:447970
  • school:shadow
  • range:6.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447970
  • name:Sikran's Endless Arsenal
  • school:shadow
  • tooltip:
  • description:{$?a447962=false}[{$@=}spellname448090 {$@spelldesc448090=Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.}]?a447978[{$@=}spellname445475 {$@spelldesc445475=Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.}]?a448036[{$@=}spellname445434 {$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }][{$@=}spellname445434 {$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }]
    Surekian Flourish 7,2060.7%1.8181.27s0.0s1,192,6450Periodic5.4302,619605,754400,07032.2%0.0%1.8%

Stats Details: Surekian Flourish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.810.005.395.390.000.00001.00002,154,967.592,154,967.590.00%400,179.680.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.84%3.6506302,619.08293,843331,912300,296.280331,9121,105,7941,105,7940.00%
crit32.16%1.7306605,753.78587,686663,823519,211.750663,8231,049,1741,049,1740.00%

Action Details: Surekian Flourish

  • id:445434
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:259256.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:445434
  • name:Surekian Flourish
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=1} sec.
  • description:Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn.
    Surekian Decimation 6,0950.6%1.8181.27s0.0s995,7360Direct1.8754,8691,509,839995,62531.9%0.0%

Stats Details: Surekian Decimation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.831.830.000.000.000.00000.00001,822,975.911,822,975.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.09%1.2502754,869.00734,608805,793650,253.800805,793941,015941,0150.00%
crit31.91%0.58021,509,839.211,469,2161,611,587752,052.2001,611,587881,961881,9610.00%

Action Details: Surekian Decimation

  • id:448090
  • school:shadow
  • range:6.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:648140.38
  • base_dd_max:648140.38
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448090
  • name:Surekian Decimation
  • school:shadow
  • tooltip:
  • description:Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.
    Surekian Barrage 4,0360.4%1.8181.27s0.0s658,9280Direct1.8502,9251,005,865659,21431.0%0.0%

Stats Details: Surekian Barrage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.831.830.000.000.000.00000.00001,207,145.701,207,145.700.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.96%1.2602502,924.79489,738537,195436,575.280537,195635,218635,2180.00%
crit31.04%0.57021,005,865.42979,4771,074,390493,211.6601,074,390571,928571,9280.00%

Action Details: Surekian Barrage

  • id:445475
  • school:shadow
  • range:6.0
  • travel_speed:40.0000
  • radius:20.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:432092.84
  • base_dd_max:432092.84
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:445475
  • name:Surekian Barrage
  • school:shadow
  • tooltip:
  • description:Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.
Suffocating Darkness 25,7272.5%19.015.31s0.0s405,4160Periodic107.172,096072,0960.0%0.0%71.4%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.040.00107.10107.1012.080.00002.00007,720,978.527,720,978.520.00%36,045.310.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.105816472,096.4533,722114,27271,555.2636,97799,3247,720,9797,720,9790.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:29752.64
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Simple Action Stats Execute Interval
Lycrow
Crystallized Augment Rune 1.00.00s0.0s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.692.06s0.0s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.640.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [I]:3.64
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&(buff.flagellation_persist.up|buff.flagellation_buff.remains<=3)
Flask of Alchemical Chaos 1.00.00s0.0s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s0.0s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.25s0.0s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [J]:1.49
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Shadow Dance 11.427.26s0.0s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.380.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [S]:11.38
  • if_expr:(variable.shd_cp|!talent.premeditation)&variable.maintenance&(cooldown.secret_technique.remains<=24|talent.the_first_dance&buff.shadow_blades.up)&(buff.symbols_of_death.remains>=6|buff.shadow_blades.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s0.0s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 12.324.93s0.0s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.260.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [K]:12.26
  • if_expr:(buff.symbols_of_death.remains<=3.5&variable.maintenance&(variable.targets>1|raid_event.adds.up|!buff.flagellation_buff.up|dot.rupture.remains>=30)&(!talent.flagellation|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Thistle Tea 4.263.66s0.0s

Stats Details: Thistle Tea

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.210.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Thistle Tea

  • id:381623
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:energy
  • energize_amount:100.0

Spelldata

  • id:381623
  • name:Thistle Tea
  • school:physical
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.

Action Priority List

    cds
    [M]:4.21
  • if_expr:buff.shadow_dance.remains>4&!buff.thistle_tea.up
Thistle Tea (_auto) 3.171.82s0.0s

Stats Details: Thistle Tea Auto

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.120.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Thistle Tea Auto

  • id:381623
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:energy
  • energize_amount:100.0

Spelldata

  • id:381623
  • name:Thistle Tea
  • school:physical
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.
Vanish 3.678.94s0.0s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.610.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [T]:3.61
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Affected By (Passive)

Type Spell ID # +/% Value
Modify Cooldown Charge (Category)Without a Trace3825131SET1.000

Buffs

Trigger CountInterval
Dynamic Buffs Start Refresh Total Start Trigger Duration Uptime Benefit Overflow Expiry
Acrobatic Strikes1.1545.3546.4147.8s0.5s271.6s99.93%100.00%535.5 (535.5)0.1

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.1s / 355.2s
  • trigger_min/max:0.0s / 5.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 360.0s
  • uptime_min/max:98.88% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.24%
  • acrobatic_strikes_3:0.23%
  • acrobatic_strikes_4:0.23%
  • acrobatic_strikes_5:0.23%
  • acrobatic_strikes_6:0.23%
  • acrobatic_strikes_7:0.23%
  • acrobatic_strikes_8:0.23%
  • acrobatic_strikes_9:0.23%
  • acrobatic_strikes_10:97.85%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.01.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clear the Witnesses12.015.227.226.2s11.3s14.7s58.64%0.00%15.2 (15.2)0.9

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_clear_the_witnesses
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 94.1s
  • trigger_min/max:4.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.3s
  • uptime_min/max:45.52% / 71.62%

Stack Uptimes

  • clear_the_witnesses_1:58.64%

Spelldata

  • id:457178
  • name:Clear the Witnesses
  • tooltip:Your next {$?=}c1[Fan of Knives][Shuriken Storm] deals additional damage and generates {$=}w1 additional combo point.
  • description:{$@spelldesc457053=Your next {$?=}c1[Fan of Knives][Shuriken Storm] after applying Deathstalker's Mark deals an additional {$457179s1=0} Plague damage and generates {$457178s1=1} additional combo point.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Cold Blood3.60.03.691.9s91.9s0.4s0.00%1.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:45.0s / 116.3s
  • trigger_min/max:45.0s / 116.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:0.00% / 0.74%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
Danse Macabre11.444.155.527.2s27.2s8.2s31.35%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 79.8s
  • trigger_min/max:8.0s / 79.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:29.31% / 34.90%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.04%
  • danse_macabre_3:4.78%
  • danse_macabre_4:6.78%
  • danse_macabre_5:15.69%
  • danse_macabre_6:0.04%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Darkest Night27.10.127.211.2s11.1s2.8s24.67%30.57%0.1 (0.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_darkest_night
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 40.8s
  • trigger_min/max:1.0s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:17.41% / 36.50%

Stack Uptimes

  • darkest_night_1:24.67%

Spelldata

  • id:457280
  • name:Darkest Night
  • tooltip:Your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deal {$=}w2% additional damage, and apply {$=}w3 stacks of Deathstalker's Mark to the target.
  • description:{$@spelldesc457058=When you consume the final Deathstalker's Mark from a target or your target dies, gain {$457280s1=40} Energy and your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deals {$457280s2=60}% additional damage, and applies {$457280s3=3} stacks of Deathstalker's Mark to the target.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Deathstalker's Mark (_buff)70.49.679.94.2s3.7s1.3s30.10%100.00%9.6 (9.6)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark_buff
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.50
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 29.7s
  • trigger_min/max:1.0s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.3s
  • uptime_min/max:25.53% / 36.16%

Stack Uptimes

  • deathstalkers_mark_buff_1:30.10%

Spelldata

  • id:457160
  • name:Deathstalker's Mark
  • tooltip:Your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] deals {$=}w1% additional damage.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers6.579.085.646.4s3.4s39.1s85.26%86.59%79.0 (79.0)5.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 98.0s
  • trigger_min/max:1.0s / 33.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 86.9s
  • uptime_min/max:77.61% / 91.16%

Stack Uptimes

  • deeper_daggers_1:85.26%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.127.891.6s9.7s11.8s14.61%0.00%9.3 (38.0)3.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 95.7s
  • trigger_min/max:1.0s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.74%

Stack Uptimes

  • flagellation_buff_1:1.27%
  • flagellation_buff_7:2.80%
  • flagellation_buff_13:2.26%
  • flagellation_buff_19:2.02%
  • flagellation_buff_25:1.96%
  • flagellation_buff_30:4.30%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=10}/10*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.03.791.4s91.4s11.8s14.19%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.0s / 95.7s
  • trigger_min/max:78.0s / 95.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.44% / 16.07%

Stack Uptimes

  • flagellation_persist_25:0.00%
  • flagellation_persist_30:14.19%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=10}/10*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.62.7111.9s76.8s35.2s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 350.1s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 81.86%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.62.8112.1s77.2s35.0s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 353.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 83.96%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.62.8111.3s76.7s35.3s25.16%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 349.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 87.81%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.16%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.62.7112.1s77.2s35.3s24.96%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 351.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 223.9s
  • uptime_min/max:0.00% / 82.55%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.96%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum of Despair4.80.85.549.2s41.1s12.6s20.01%14.76%0.8 (0.8)4.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_momentum_of_despair
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.15
  • is_stacking:false

Trigger Details

  • interval_min/max:12.0s / 284.5s
  • trigger_min/max:2.0s / 284.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.7s
  • uptime_min/max:0.00% / 48.93%

Stack Uptimes

  • momentum_of_despair_1:20.01%

Spelldata

  • id:457115
  • name:Momentum of Despair
  • tooltip:Critical strike chance of {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm] and {$?s121411=false}[Crimson Tempest]{$?s319175=true}[Black Powder] increased by {$=}w1% and critical strike damage increased by {$=}w2%.
  • description:{$@spelldesc457067=If you have critically struck with {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm], increase the critical strike chance of {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm] and {$?s121411=false}[Crimson Tempest]{$?s319175=true}[Black Powder] by {$457115s1=15}% and critical strike damage by {$457115s2=32}% for {$457115d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Now is the time!4.90.04.965.8s65.8s9.8s16.01%0.00%0.0 (0.0)4.7

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_now_is_the_time
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Mithril Wristwatch

Stat Details

  • stat:spell_power
  • amount:24890.79

Trigger Details

  • interval_min/max:55.0s / 159.3s
  • trigger_min/max:55.0s / 159.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:7.49% / 20.79%

Stack Uptimes

  • now_is_the_time_1:16.01%

Spelldata

  • id:127923
  • name:Now is the time!
  • tooltip:Increases spell power by {$s1=11380}.
  • description:Increases spell power by {$s1=11380} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Blades3.70.03.791.3s91.3s15.7s19.17%14.53%0.0 (0.0)3.5

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 101.1s
  • trigger_min/max:90.0s / 101.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.77% / 21.80%

Stack Uptimes

  • shadow_blades_1:19.17%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance11.40.011.427.2s27.2s8.2s31.35%100.00%0.0 (0.0)11.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 79.8s
  • trigger_min/max:8.0s / 79.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:29.31% / 34.90%

Stack Uptimes

  • shadow_dance_1:31.35%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.1122.3190.34.4s1.6s3.4s76.88%85.92%0.2 (0.3)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_shadow_techniques
  • max_stacks:12
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 49.2s
  • trigger_min/max:0.4s / 7.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s
  • uptime_min/max:66.18% / 85.10%

Stack Uptimes

  • shadow_techniques_1:19.29%
  • shadow_techniques_2:19.62%
  • shadow_techniques_3:10.37%
  • shadow_techniques_4:11.00%
  • shadow_techniques_5:6.93%
  • shadow_techniques_6:4.52%
  • shadow_techniques_7:3.08%
  • shadow_techniques_8:1.03%
  • shadow_techniques_9:0.69%
  • shadow_techniques_10:0.16%
  • shadow_techniques_11:0.10%
  • shadow_techniques_12:0.09%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.01.00.0s0.0s290.2s96.67%74.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.0s / 350.8s
  • uptime_min/max:95.81% / 97.73%

Stack Uptimes

  • slice_and_dice_1:96.67%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=false}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stance - Surekian Barrage2.20.02.2164.3s181.3s54.9s33.51%0.00%49.8 (49.8)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_barrage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:120.1s / 183.0s
  • trigger_min/max:180.1s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.1s
  • uptime_min/max:19.89% / 50.12%

Stack Uptimes

  • stance__surekian_barrage_1:33.51%

Spelldata

  • id:448036
  • name:Stance - Surekian Barrage
  • tooltip:Remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for 6 sec upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$t1=2} sec, up to {$448433u=5} times.
  • description:{$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Stance - Surekian Decimation2.20.02.2164.2s181.3s54.9s33.49%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_decimation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.1s / 182.9s
  • trigger_min/max:180.1s / 182.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 61.1s
  • uptime_min/max:19.86% / 50.10%

Stack Uptimes

  • stance__surekian_decimation_1:33.49%

Spelldata

  • id:447978
  • name:Stance - Surekian Decimation
  • tooltip:Your critical strikes deal {$445203s5=10}% additional damage to absorb shields.
  • description:{$@spelldesc448090=Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Stance - Surekian Flourish2.20.02.2162.8s181.2s54.8s33.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_flourish
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:parry_rating
  • amount:0.00
  • stat:avoidance_rating
  • amount:0.00

Trigger Details

  • interval_min/max:120.1s / 182.8s
  • trigger_min/max:180.1s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.1s
  • uptime_min/max:19.86% / 50.13%

Stack Uptimes

  • stance__surekian_flourish_1:33.00%

Spelldata

  • id:447962
  • name:Stance - Surekian Flourish
  • tooltip:Parry increased by {$=}w1. Avoidance increased by {$=}w2.
  • description:{$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.01.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge4.60.04.664.3s78.5s6.0s9.20%0.00%0.0 (0.0)4.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 152.1s
  • trigger_min/max:6.0s / 152.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:8.07% / 11.34%

Stack Uptimes

  • subterfuge_1:9.20%

Spelldata

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Abilities requiring Stealth can be used for {$=}{{$s2=3000}/1000} sec after Stealth breaks. Combat benefits requiring Stealth persist for an additional {$=}{{$s2=3000}/1000} sec after Stealth breaks.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Surekian Grace23.848.872.69.8s3.3s10.0s78.95%0.00%48.8 (48.8)22.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_surekian_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 68.9s
  • trigger_min/max:2.0s / 6.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:48.59% / 99.44%

Stack Uptimes

  • surekian_grace_1:78.95%

Spelldata

  • id:448436
  • name:Surekian Grace
  • tooltip:Movement speed increased by {$=}w1%.
  • description:{$@spelldesc448433={$@spelldesc445475=Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.}}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Symbolic Victory12.20.112.325.1s24.9s2.2s8.31%100.00%0.1 (0.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_symbolic_victory
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.18
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:1.0s / 69.2s
  • trigger_min/max:1.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.7s
  • uptime_min/max:4.10% / 14.06%

Stack Uptimes

  • symbolic_victory_1:8.31%

Spelldata

  • id:457167
  • name:Symbolic Victory
  • tooltip:Damage of your next {$?a137037=false} [Envenom][Eviscerate or Black Powder] is increased by {$=}w1%.
  • description:{$@spelldesc457062={$?a137037=false} [Shiv][Symbols of Death] additionally increases the damage of your next {$?a137037=false} [Envenom][Eviscerate or Black Powder] by {$457167s1=18}%.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death11.60.712.326.2s24.9s14.0s54.17%100.00%0.7 (0.7)10.9

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.0s / 82.3s
  • trigger_min/max:1.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:47.71% / 58.53%

Stack Uptimes

  • symbols_of_death_1:54.17%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.01.5307.5s307.5s27.4s13.35%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.9s
  • trigger_min/max:300.0s / 329.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.93% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.35%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.01.00.0s0.0s6.8s2.31%4.44%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:4.0s / 7.0s
  • uptime_min/max:1.29% / 2.93%

Stack Uptimes

  • the_first_dance_1:2.31%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten12.20.112.325.0s24.9s2.1s8.59%15.30%0.1 (0.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 69.2s
  • trigger_min/max:1.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:6.21% / 11.53%

Stack Uptimes

  • the_rotten_1:7.99%
  • the_rotten_2:0.61%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Thistle Tea7.30.07.341.2s41.2s6.0s14.68%0.00%0.0 (0.0)7.3

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_thistle_tea
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:8.00%

Trigger Details

  • interval_min/max:6.0s / 100.9s
  • trigger_min/max:6.0s / 100.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:12.78% / 16.66%

Stack Uptimes

  • thistle_tea_1:14.68%

Spelldata

  • id:381623
  • name:Thistle Tea
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.
  • max_stacks:0
  • duration:6.00
  • cooldown:1.00
  • default_chance:0.00%
Vanish3.60.03.678.5s78.5s0.1s0.15%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 152.1s
  • trigger_min/max:6.0s / 152.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.6s
  • uptime_min/max:0.00% / 0.54%

Stack Uptimes

  • vanish_1:0.15%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
CP Spent During Flagellation143.9102.0174.011.1s1.0s85.9s
Cold Blood secret_technique3.63.06.091.9s45.0s116.3s
Skyfury (Main Hand)45.621.074.06.4s0.8s81.7s
Skyfury (Off Hand)45.518.075.06.5s0.8s83.3s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap6.80%3.65%10.76%0.5s0.0s1.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Lycrow
Darkest NightEnergy27.20779.407.82%28.65308.6528.37%
Energy RegenEnergy1,135.593,393.3034.05%2.99362.699.66%
Improved AmbushCombo Points48.5628.364.43%0.5820.2041.59%
Relentless StrikesEnergy106.093,177.5931.88%29.955.160.16%
Shadow BladesCombo Points23.12101.3115.82%4.3837.4126.97%
Shadow TechniquesEnergy311.611,892.8118.99%6.07288.4613.22%
Shadow TechniquesCombo Points85.73206.8732.31%2.410.000.00%
Shadow Techniques (Shadowcraft)Combo Points16.98101.8615.91%6.000.000.00%
GloombladeCombo Points100.2089.4813.97%0.8910.7210.70%
ShadowstrikeCombo Points48.5692.4214.43%1.904.694.83%
Shuriken StormCombo Points10.3720.003.12%1.930.753.60%
Symbols of DeathEnergy12.26330.403.32%26.96159.8832.61%
Thistle TeaEnergy4.2180.600.81%19.16340.1280.84%
Thistle Tea (_auto)Energy3.12312.383.13%100.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
Lycrow
EviscerateEnergy85.562,928.2529.21%34.2334.2328,930.36
EviscerateCombo Points85.56513.3480.64%6.006.00165,029.26
GloombladeEnergy100.203,984.7239.75%39.7739.775,572.83
RuptureEnergy10.63265.702.65%25.0025.00130,671.70
RuptureCombo Points10.6363.7710.02%6.006.00544,465.40
Secret TechniqueEnergy9.91282.372.82%28.5028.5076,617.57
Secret TechniqueCombo Points9.9159.459.34%6.006.00363,933.48
ShadowstrikeEnergy48.562,098.3120.93%43.2143.2113,134.11
Shuriken StormEnergy10.37466.034.65%44.9344.935,894.49
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy200.033.2233.421,465.0140.91.0200.0
Combo Points0.02.132.1273.83.80.06.0

Statistics & Data Analysis

Fight Length
Lycrow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Lycrow Damage Per Second
Count 9999
Mean 1027248.17
Minimum 941045.05
Maximum 1120573.14
Spread ( max - min ) 179528.09
Range [ ( max - min ) / 2 * 100% ] 8.74%
Standard Deviation 23855.5802
5th Percentile 989079.78
95th Percentile 1067357.81
( 95th Percentile - 5th Percentile ) 78278.03
Mean Distribution
Standard Deviation 238.5677
95.00% Confidence Interval ( 1026780.58 - 1027715.75 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2072
0.1 Scale Factor Error with Delta=300 4858069
0.05 Scale Factor Error with Delta=300 19432275
0.01 Scale Factor Error with Delta=300 485806853
Priority Target DPS
Lycrow Priority Target Damage Per Second
Count 9999
Mean 1027248.17
Minimum 941045.05
Maximum 1120573.14
Spread ( max - min ) 179528.09
Range [ ( max - min ) / 2 * 100% ] 8.74%
Standard Deviation 23855.5802
5th Percentile 989079.78
95th Percentile 1067357.81
( 95th Percentile - 5th Percentile ) 78278.03
Mean Distribution
Standard Deviation 238.5677
95.00% Confidence Interval ( 1026780.58 - 1027715.75 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2072
0.1 Scale Factor Error with Delta=300 4858069
0.05 Scale Factor Error with Delta=300 19432275
0.01 Scale Factor Error with Delta=300 485806853
DPS(e)
Lycrow Damage Per Second (Effective)
Count 9999
Mean 1027248.17
Minimum 941045.05
Maximum 1120573.14
Spread ( max - min ) 179528.09
Range [ ( max - min ) / 2 * 100% ] 8.74%
Damage
Lycrow Damage
Count 9999
Mean 307911042.28
Minimum 237957491.69
Maximum 374880267.34
Spread ( max - min ) 136922775.65
Range [ ( max - min ) / 2 * 100% ] 22.23%
DTPS
Lycrow Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Lycrow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Lycrow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Lycrow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Lycrow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_use_buff&(!trinket.1.has_use_buff|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|buff.darkest_night.up|variable.targets>=4&(!talent.replicating_shadows&talent.unseen_blade|raid_event.adds.up)
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&(buff.slice_and_dice.up|variable.targets<=2)
0.00 variable,name=secret,value=buff.shadow_dance.up&!buff.darkest_night.up|(cooldown.flagellation.remains<60&cooldown.flagellation.remains>30&talent.death_perception&talent.unseen_blade)
0.00 variable,name=racial_sync,value=(buff.shadow_blades.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
7 0.00 call_action_list,name=race
8 0.00 call_action_list,name=item
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend|action.coup_de_grace.ready&cooldown.secret_technique.remains>0
B 0.00 call_action_list,name=build
C 0.00 call_action_list,name=fill,if=!variable.stealth
actions.build
# count action,conditions
0.00 backstab,if=(talent.unseen_blade|variable.targets<=2)&(buff.shadow_dance.up&(buff.premeditation.up|buff.shadow_blades.up)&!used_for_danse|!variable.stealth&buff.shadow_blades.up)
D 15.14 gloomblade,if=buff.shadow_dance.up&!used_for_danse|!variable.stealth&buff.shadow_blades.up
E 25.84 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=3
0.00 shuriken_tornado,if=talent.unseen_blade&!buff.stealth.up&((buff.shadow_dance.up&!talent.shadowcraft&variable.targets>=3)|(talent.shadowcraft&variable.targets>=3)|!variable.stealth&variable.targets<=2)&(buff.symbols_of_death.up|!raid_event.adds.up)
F 10.37 shuriken_storm,if=buff.clear_the_witnesses.up&(variable.targets>=2|!buff.symbols_of_death.up)
0.00 shadowstrike,cycle_targets=1,if=talent.deathstalkers_mark&!debuff.deathstalkers_mark.up&variable.targets>=3&(buff.shadow_blades.up|buff.premeditation.up|talent.the_rotten)
0.00 shuriken_storm,if=talent.deathstalkers_mark&variable.targets>=(2+3*buff.shadow_dance.up)
0.00 shuriken_storm,if=talent.unseen_blade&(buff.flawless_form.up&variable.targets>=3&!variable.stealth|buff.silent_storm.up&variable.targets>=5&buff.shadow_dance.up)
0.00 shuriken_storm,if=(buff.tww3_trickster_4pc.up|buff.escalating_blade.stack=4)&!used_for_danse&(buff.shadow_blades.up|variable.targets>=4)
G 22.72 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
H 85.06 gloomblade
0.00 backstab
actions.cds
# count action,conditions
I 3.64 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&(buff.flagellation_persist.up|buff.flagellation_buff.remains<=3)
J 1.49 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
K 12.26 symbols_of_death,if=(buff.symbols_of_death.remains<=3.5&variable.maintenance&(variable.targets>1|raid_event.adds.up|!buff.flagellation_buff.up|dot.rupture.remains>=30)&(!talent.flagellation|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
L 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
M 4.21 thistle_tea,if=buff.shadow_dance.remains>4&!buff.thistle_tea.up
N 3.70 flagellation,if=combo_points>=5&cooldown.shadow_blades.remains<=3|fight_remains<=25
actions.finish
# count action,conditions
O 9.91 secret_technique,if=variable.secret
P 10.63 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable|buff.flagellation_buff.up&!buff.symbols_of_death.up&variable.targets<=2)&target.time_to_die-remains>6&cooldown.flagellation.remains>=10
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
0.00 coup_de_grace,if=debuff.fazed.up&cooldown.flagellation.remains>=20|fight_remains<=10
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&(((variable.targets>=2&talent.deathstalkers_mark&(!buff.darkest_night.up|buff.shadow_dance.up&variable.targets>=5))|talent.unseen_blade&variable.targets>=4)|action.coup_de_grace.ready&variable.targets>=3)
Q 85.56 eviscerate,if=cooldown.flagellation.remains>=10|variable.targets>=3
actions.item
# count action,conditions
0.00 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
0.00 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=cursed_stone_idol,use_off_gcd=1,if=dot.rupture.remains>=25&buff.flagellation_buff.up|fight_remains<=20
0.00 use_item,name=unyielding_netherprism,use_off_gcd=1,if=buff.shadow_blades.up&(buff.latent_energy.stack>=8+8*(trinket.arazs_ritual_forge.cooldown.ready|!equipped.arazs_ritual_forge)|!equipped.arazs_ritual_forge&fight_remains<=90)|fight_remains<=20
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
R 5.47 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
S 11.38 shadow_dance,if=(variable.shd_cp|!talent.premeditation)&variable.maintenance&(cooldown.secret_technique.remains<=24|talent.the_first_dance&buff.shadow_blades.up)&(buff.symbols_of_death.remains>=6|buff.shadow_blades.remains>=6)|fight_remains<=10
T 3.61 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

025REJENPEPKSLMDOEQGQMQGQGQQTEQKSMDQQIOEQGQTEQEQQEEQFHQKSDEOGQGQGQHHPHHQFHQKSDEQRGGOGQHQHHQHHPFQHHHHQHHHHHHHHHNQFPKSLDOEQQGQGQQDQDQKDQQSQDEIOGQGRQHHQFQHHHHPHHHHQKHTEQEQSDEOGQGQGQFQHHHHQHHHHQFHPHHHHHRHNPKSLMDOQEQQGQDQQDQKDQQHSDIOEQGGQGQHFQHHHPHHHQKHHQHHQHHQHHHQHRQFHHPHHHQHHHHQTEQEHHHFHNPKSLDOQEQQGQKSQDQQEQIOGQHQHHHQ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
the_first_dance, flask_of_alchemical_chaos_haste
Pre2priority_rotation
[precombat]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
the_first_dance, flask_of_alchemical_chaos_haste
Pre5stealth
[precombat]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
the_first_dance, flask_of_alchemical_chaos_haste
0:00.000Ruse_items
[item]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
stealth, the_first_dance, flask_of_alchemical_chaos_haste
0:00.000Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, stealth, the_first_dance, flask_of_alchemical_chaos_haste
0:01.003Jpotion
[cds]
Fluffy_Pillow 180.5/200 90% energy
3.0/6 50% CP
bloodlust, acrobatic_strikes(3), subterfuge, clear_the_witnesses, shadow_techniques, the_first_dance, flask_of_alchemical_chaos_haste
0:01.003Eshadowstrike
[build]
Fluffy_Pillow 180.5/200 90% energy
3.0/6 50% CP
bloodlust, acrobatic_strikes(3), subterfuge, clear_the_witnesses, shadow_techniques, the_first_dance, flask_of_alchemical_chaos_haste, tempered_potion
0:02.006Nflagellation
[cds]
Fluffy_Pillow 151.5/200 76% energy
6.0/6 100% CP
bloodlust, acrobatic_strikes(5), subterfuge, clear_the_witnesses, shadow_techniques, the_first_dance, now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:03.010Prupture
[finish]
Fluffy_Pillow 174.5/200 87% energy
6.0/6 100% CP
bloodlust, acrobatic_strikes(7), subterfuge, clear_the_witnesses, shadow_techniques(2), the_first_dance, flagellation_buff, now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:04.015Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(3), the_first_dance, flagellation_buff(7), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.019Prupture
[finish]
Fluffy_Pillow 178.0/200 89% energy
6.0/6 100% CP
bloodlust, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, the_first_dance, flagellation_buff(7), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.024Ksymbols_of_death
[cds]
Lycrow 199.0/200 99% energy
0.0/6 0% CP
bloodlust, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques, the_first_dance, flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.024Sshadow_dance
[stealth_cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques, the_first_dance, the_rotten(2), flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.024Lshadow_blades
[cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques, the_rotten(2), flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.024Mthistle_tea
[cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques, the_rotten(2), flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.024Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques, the_rotten(2), flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:07.030Osecret_technique
[finish]
Fluffy_Pillow 178.0/200 89% energy
6.0/6 100% CP
bloodlust, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, symbolic_victory, shadow_techniques, the_rotten, flagellation_buff(13), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:08.036Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, darkest_night, deathstalkers_mark_buff, symbolic_victory, shadow_techniques, the_rotten, flagellation_buff(19), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:09.040Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, darkest_night, symbolic_victory, shadow_techniques(3), flagellation_buff(19), now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:10.046Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(7), flagellation_buff(25), deeper_daggers, now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:11.050Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(9), flagellation_buff(25), deeper_daggers, now_is_the_time, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.053Mthistle_tea
[cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(3), flagellation_buff(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.053Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(3), flagellation_buff(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:13.058Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(5), flagellation_buff(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.061Qeviscerate
[finish]
Fluffy_Pillow 173.2/200 87% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:15.065Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.069Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, darkest_night, shadow_techniques(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.074Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.078Tvanish
[stealth_cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.078Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, vanish, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.082Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, slice_and_dice, shadow_blades, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.086Ksymbols_of_death
[cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, shadow_blades, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(10), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.086Sshadow_dance
[stealth_cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.086Mthistle_tea
[cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.086Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.091Qeviscerate
[finish]
Fluffy_Pillow 192.0/200 96% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, thistle_tea, clear_the_witnesses, symbolic_victory, shadow_techniques(12), the_rotten, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.096Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, thistle_tea, clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.100Icold_blood
[cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.100Osecret_technique
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), cold_blood, subterfuge, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.105Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.109Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.114Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.118Qeviscerate
[finish]
Fluffy_Pillow 187.2/200 94% energy
6.0/6 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.122Tvanish
[stealth_cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(8), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.122Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(8), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.125Qeviscerate
[finish]
Fluffy_Pillow 173.2/200 87% energy
6.0/6 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, darkest_night, shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.130Eshadowstrike
[build]
Fluffy_Pillow 198.2/200 99% energy
0.0/6 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.135Qeviscerate
[finish]
Fluffy_Pillow 183.2/200 92% energy
6.0/6 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
0:32.140Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:33.145Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:34.149Eshadowstrike
[build]
Fluffy_Pillow 178.2/200 89% energy
5.0/6 83% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:35.151Qeviscerate
[finish]
Fluffy_Pillow 149.4/200 75% energy
6.0/6 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:36.158Fshuriken_storm
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:37.163Hgloomblade
[build]
Fluffy_Pillow 178.3/200 89% energy
4.0/6 67% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:38.167Qeviscerate
[finish]
Fluffy_Pillow 154.5/200 77% energy
6.0/6 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), darkest_night, momentum_of_despair, deeper_daggers, flask_of_alchemical_chaos_haste
0:39.172Ksymbols_of_death
[cds]
Lycrow 172.8/200 86% energy
0.0/6 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:39.172Sshadow_dance
[stealth_cds]
Lycrow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, symbolic_victory, shadow_techniques, the_rotten(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:39.172Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, symbolic_victory, shadow_techniques, the_rotten(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:40.177Eshadowstrike
[build]
Fluffy_Pillow 191.6/200 96% energy
2.0/6 33% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, symbolic_victory, shadow_techniques(2), the_rotten, deeper_daggers, flask_of_alchemical_chaos_haste
0:41.181Osecret_technique
[finish]
Fluffy_Pillow 161.3/200 81% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, symbolic_victory, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:42.185Gshadowstrike
[build]
Fluffy_Pillow 189.3/200 95% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
0:43.190Qeviscerate
[finish]
Fluffy_Pillow 187.1/200 94% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, symbolic_victory, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
0:44.193Gshadowstrike
[build]
Fluffy_Pillow 196.3/200 98% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
0:45.197Qeviscerate
[finish]
Fluffy_Pillow 180.1/200 90% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
0:46.204Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
0:47.208Qeviscerate
[finish]
Fluffy_Pillow 183.7/200 92% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, momentum_of_despair, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:48.213Hgloomblade
[build]
Fluffy_Pillow 191.2/200 96% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:49.219Hgloomblade
[build]
Fluffy_Pillow 177.8/200 89% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:50.224Prupture
[finish]
Fluffy_Pillow 164.3/200 82% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:51.228Hgloomblade
[build]
Fluffy_Pillow 181.8/200 91% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:52.233Hgloomblade
[build]
Fluffy_Pillow 168.3/200 84% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:53.238Qeviscerate
[finish]
Fluffy_Pillow 140.8/200 70% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deeper_daggers, flask_of_alchemical_chaos_haste
0:54.241Fshuriken_storm
[build]
Fluffy_Pillow 162.2/200 81% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:55.246Hgloomblade
[build]
Fluffy_Pillow 136.8/200 68% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
0:56.250Qeviscerate
[finish]
Fluffy_Pillow 109.2/200 55% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, deeper_daggers, flask_of_alchemical_chaos_haste
0:57.253Ksymbols_of_death
[cds]
Lycrow 156.7/200 78% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, deeper_daggers, flask_of_alchemical_chaos_haste
0:57.253Sshadow_dance
[stealth_cds]
Lycrow 196.7/200 98% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, the_rotten(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:57.253Dgloomblade
[build]
Fluffy_Pillow 196.7/200 98% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, the_rotten(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:58.258Eshadowstrike
[build]
Fluffy_Pillow 185.2/200 93% energy
1.0/6 17% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), darkest_night, momentum_of_despair, symbolic_victory, shadow_techniques(2), the_rotten, deeper_daggers, now_is_the_time, flask_of_alchemical_chaos_haste
0:59.262Qeviscerate
[finish]
Fluffy_Pillow 155.0/200 77% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, momentum_of_despair, symbolic_victory, deeper_daggers, now_is_the_time, flask_of_alchemical_chaos_haste
1:00.268Ruse_items
[item]
Fluffy_Pillow 178.2/200 89% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(2), deeper_daggers, now_is_the_time, flask_of_alchemical_chaos_haste
1:00.268Gshadowstrike
[build]
Fluffy_Pillow 178.2/200 89% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(2), deeper_daggers, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:01.272Gshadowstrike
[build]
Fluffy_Pillow 161.9/200 81% energy
5.0/6 83% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(2), deeper_daggers, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:02.277Osecret_technique
[finish]
Fluffy_Pillow 145.0/200 73% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:03.282Gshadowstrike
[build]
Fluffy_Pillow 172.4/200 86% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(6), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:04.286Qeviscerate
[finish]
Fluffy_Pillow 155.6/200 78% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(5), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:05.291Hgloomblade
[build]
Fluffy_Pillow 164.3/200 82% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(5), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:06.296Qeviscerate
[finish]
Fluffy_Pillow 164.2/200 82% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:07.300Hgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_mastery
1:08.306Hgloomblade
[build]
Fluffy_Pillow 185.9/200 93% energy
5.0/6 83% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:09.310Qeviscerate
[finish]
Fluffy_Pillow 157.8/200 79% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:10.315Hgloomblade
[build]
Fluffy_Pillow 164.7/200 82% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:11.319Hgloomblade
[build]
Fluffy_Pillow 164.6/200 82% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:12.324Prupture
[finish]
Fluffy_Pillow 150.5/200 75% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:13.328Fshuriken_storm
[build]
Fluffy_Pillow 167.4/200 84% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:14.332Qeviscerate
[finish]
Fluffy_Pillow 141.3/200 71% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:15.337Hgloomblade
[build]
Fluffy_Pillow 148.3/200 74% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:16.342Hgloomblade
[build]
Fluffy_Pillow 127.2/200 64% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:17.346Hgloomblade
[build]
Fluffy_Pillow 99.1/200 50% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:18.352Hgloomblade
[build]
Fluffy_Pillow 78.0/200 39% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:19.357Qeviscerate
[finish]
Fluffy_Pillow 49.9/200 25% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:20.361Hgloomblade
[build]
Fluffy_Pillow 96.8/200 48% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:21.364Hgloomblade
[build]
Fluffy_Pillow 75.7/200 38% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:22.368Hgloomblade
[build]
Fluffy_Pillow 54.6/200 27% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:23.372Hgloomblade
[build]
Fluffy_Pillow 133.5/200 67% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:24.378Hgloomblade
[build]
Fluffy_Pillow 105.4/200 53% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:25.383Hgloomblade
[build]
Fluffy_Pillow 84.3/200 42% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:26.386Hgloomblade
[build]
Fluffy_Pillow 56.2/200 28% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:27.902Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, shadow_techniques(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:30.686Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques(4), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_mastery
1:33.133Nflagellation
[cds]
Fluffy_Pillow 38.4/200 19% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques(5), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:34.136Qeviscerate
[finish]
Fluffy_Pillow 50.9/200 25% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques(5), flagellation_buff, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:35.143Fshuriken_storm
[build]
Fluffy_Pillow 65.4/200 33% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(6), flagellation_buff(7), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:36.147Prupture
[finish]
Fluffy_Pillow 32.9/200 16% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques(2), flagellation_buff(7), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:37.150Ksymbols_of_death
[cds]
Lycrow 57.4/200 29% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(3), flagellation_buff(13), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:37.150Sshadow_dance
[stealth_cds]
Lycrow 97.4/200 49% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, shadow_techniques(3), the_rotten(2), flagellation_buff(13), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:37.150Lshadow_blades
[cds]
Lycrow 97.4/200 49% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, shadow_techniques(3), the_rotten(2), flagellation_buff(13), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:37.150Dgloomblade
[build]
Fluffy_Pillow 97.4/200 49% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, shadow_techniques(3), the_rotten(2), flagellation_buff(13), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:38.155Osecret_technique
[finish]
Fluffy_Pillow 71.9/200 36% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), momentum_of_despair, symbolic_victory, shadow_techniques(3), the_rotten, flagellation_buff(13), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:39.159Eshadowstrike
[build]
Fluffy_Pillow 99.9/200 50% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, symbolic_victory, shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:40.163Qeviscerate
[finish]
Fluffy_Pillow 83.6/200 42% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), momentum_of_despair, symbolic_victory, shadow_techniques(7), flagellation_buff(19), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:41.167Qeviscerate
[finish]
Fluffy_Pillow 146.8/200 73% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(3), flagellation_buff(25), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:42.171Gshadowstrike
[build]
Fluffy_Pillow 170.1/200 85% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(5), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:43.174Qeviscerate
[finish]
Fluffy_Pillow 139.8/200 70% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(5), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:44.179Gshadowstrike
[build]
Fluffy_Pillow 149.1/200 75% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(5), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:45.184Qeviscerate
[finish]
Fluffy_Pillow 132.8/200 66% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, momentum_of_despair, shadow_techniques(7), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:46.189Qeviscerate
[finish]
Fluffy_Pillow 154.3/200 77% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(3), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:47.193Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(5), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:48.199Qeviscerate
[finish]
Fluffy_Pillow 172.5/200 86% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(5), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:49.205Dgloomblade
[build]
Fluffy_Pillow 194.0/200 97% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(7), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:50.208Qeviscerate
[finish]
Fluffy_Pillow 180.5/200 90% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(9), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:51.212Ksymbols_of_death
[cds]
Lycrow 195.0/200 98% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(10), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:51.212Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:52.216Qeviscerate
[finish]
Fluffy_Pillow 172.5/200 86% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, symbolic_victory, shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:53.220Qeviscerate
[finish]
Fluffy_Pillow 194.0/200 97% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:54.226Sshadow_dance
[stealth_cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:54.226Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:55.231Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:56.236Eshadowstrike
[build]
Fluffy_Pillow 188.5/200 94% energy
3.0/6 50% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:57.242Icold_blood
[cds]
Lycrow 172.3/200 86% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:57.242Osecret_technique
[finish]
Fluffy_Pillow 172.3/200 86% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), cold_blood, clear_the_witnesses, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:58.246Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(6), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
1:59.250Qeviscerate
[finish]
Fluffy_Pillow 183.7/200 92% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(5), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
2:00.255Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(7), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
2:01.259Ruse_items
[item]
Fluffy_Pillow 169.7/200 85% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
2:01.259Qeviscerate
[finish]
Fluffy_Pillow 169.7/200 85% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
2:02.262Hgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
2:03.267Hgloomblade
[build]
Fluffy_Pillow 186.5/200 93% energy
5.0/6 83% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
2:04.273Qeviscerate
[finish]
Fluffy_Pillow 173.0/200 87% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:05.278Fshuriken_storm
[build]
Fluffy_Pillow 180.5/200 90% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:06.282Qeviscerate
[finish]
Fluffy_Pillow 155.0/200 78% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:07.289Hgloomblade
[build]
Fluffy_Pillow 162.5/200 81% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:08.292Hgloomblade
[build]
Fluffy_Pillow 135.0/200 68% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:09.298Hgloomblade
[build]
Fluffy_Pillow 114.5/200 57% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:10.302Hgloomblade
[build]
Fluffy_Pillow 87.0/200 44% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:11.308Prupture
[finish]
Fluffy_Pillow 66.6/200 33% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:12.313Hgloomblade
[build]
Fluffy_Pillow 84.1/200 42% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:13.317Hgloomblade
[build]
Fluffy_Pillow 56.5/200 28% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:14.321Hgloomblade
[build]
Fluffy_Pillow 136.0/200 68% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, shadow_techniques, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:15.325Hgloomblade
[build]
Fluffy_Pillow 115.5/200 58% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, shadow_techniques, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:16.330Qeviscerate
[finish]
Fluffy_Pillow 88.0/200 44% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, shadow_techniques, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:17.333Ksymbols_of_death
[cds]
Lycrow 142.5/200 71% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, darkest_night, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:17.333Hgloomblade
[build]
Fluffy_Pillow 182.5/200 91% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), thistle_tea, darkest_night, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(2), the_rotten(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:18.337Tvanish
[stealth_cds]
Lycrow 155.0/200 78% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), thistle_tea, darkest_night, symbolic_victory, the_rotten, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:18.337Eshadowstrike
[build]
Fluffy_Pillow 155.0/200 78% energy
3.0/6 50% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), thistle_tea, darkest_night, symbolic_victory, the_rotten, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:19.341Qeviscerate
[finish]
Fluffy_Pillow 138.7/200 69% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, darkest_night, symbolic_victory, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:20.346Eshadowstrike
[build]
Fluffy_Pillow 160.3/200 80% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:21.350Qeviscerate
[finish]
Fluffy_Pillow 127.7/200 64% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:22.354Sshadow_dance
[stealth_cds]
Lycrow 135.2/200 68% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:22.354Dgloomblade
[build]
Fluffy_Pillow 135.2/200 68% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:23.358Eshadowstrike
[build]
Fluffy_Pillow 123.7/200 62% energy
2.0/6 33% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:24.363Osecret_technique
[finish]
Fluffy_Pillow 93.5/200 47% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:25.368Gshadowstrike
[build]
Fluffy_Pillow 121.5/200 61% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(3), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:26.372Qeviscerate
[finish]
Fluffy_Pillow 105.2/200 53% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:27.377Gshadowstrike
[build]
Fluffy_Pillow 168.5/200 84% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:28.381Qeviscerate
[finish]
Fluffy_Pillow 152.2/200 76% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(3), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:29.389Gshadowstrike
[build]
Fluffy_Pillow 175.5/200 88% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(5), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:30.396Qeviscerate
[finish]
Fluffy_Pillow 159.3/200 80% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:31.398Fshuriken_storm
[build]
Fluffy_Pillow 166.8/200 83% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:32.402Qeviscerate
[finish]
Fluffy_Pillow 134.3/200 67% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:33.404Hgloomblade
[build]
Fluffy_Pillow 148.7/200 74% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:34.408Hgloomblade
[build]
Fluffy_Pillow 121.2/200 61% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:35.412Hgloomblade
[build]
Fluffy_Pillow 100.7/200 50% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:36.417Hgloomblade
[build]
Fluffy_Pillow 80.2/200 40% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:37.422Qeviscerate
[finish]
Fluffy_Pillow 52.7/200 26% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:38.426Hgloomblade
[build]
Fluffy_Pillow 100.2/200 50% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:39.430Hgloomblade
[build]
Fluffy_Pillow 72.7/200 36% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, momentum_of_despair, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:40.433Hgloomblade
[build]
Fluffy_Pillow 52.2/200 26% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:42.680Hgloomblade
[build]
Fluffy_Pillow 47.1/200 24% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, momentum_of_despair, shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:44.802Qeviscerate
[finish]
Fluffy_Pillow 40.5/200 20% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:45.806Fshuriken_storm
[build]
Fluffy_Pillow 48.0/200 24% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:48.314Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:49.700Prupture
[finish]
Fluffy_Pillow 32.5/200 16% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:50.705Hgloomblade
[build]
Fluffy_Pillow 50.0/200 25% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:52.761Hgloomblade
[build]
Fluffy_Pillow 42.6/200 21% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:55.306Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:57.959Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
3:00.611Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(3), stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
3:01.615Ruse_items
[item]
Fluffy_Pillow 20.4/200 10% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(4), stance__surekian_flourish, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_crit
3:02.765Hgloomblade
[build]
Fluffy_Pillow 41.1/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(5), stance__surekian_decimation, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_crit
3:04.946Nflagellation
[cds]
Fluffy_Pillow 26.9/200 13% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(5), stance__surekian_decimation, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_crit
3:05.952Prupture
[finish]
Fluffy_Pillow 45.8/200 23% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(6), flagellation_buff, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:06.957Ksymbols_of_death
[cds]
Lycrow 62.7/200 31% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques(6), flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:06.957Sshadow_dance
[stealth_cds]
Lycrow 102.7/200 51% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:06.957Lshadow_blades
[cds]
Lycrow 102.7/200 51% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:07.150Mthistle_tea
[cds]
Lycrow 105.0/200 53% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:07.150Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:08.155Osecret_technique
[finish]
Fluffy_Pillow 187.9/200 94% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, symbolic_victory, shadow_techniques(8), the_rotten, flagellation_buff(7), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:09.159Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, darkest_night, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(4), the_rotten, flagellation_buff(13), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:10.163Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), the_rotten, flagellation_buff(19), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:11.168Qeviscerate
[finish]
Fluffy_Pillow 183.2/200 92% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, shadow_techniques(6), flagellation_buff(19), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:12.172Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_buff(25), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:13.175Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_buff(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:14.180Qeviscerate
[finish]
Fluffy_Pillow 183.2/200 92% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), flagellation_buff(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:15.184Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), flagellation_buff(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:16.188Qeviscerate
[finish]
Fluffy_Pillow 185.9/200 93% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(6), flagellation_buff(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:17.194Qeviscerate
[finish]
Fluffy_Pillow 192.8/200 96% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:18.199Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:19.204Qeviscerate
[finish]
Fluffy_Pillow 185.9/200 93% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:20.210Ksymbols_of_death
[cds]
Lycrow 192.8/200 96% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:20.210Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:21.216Qeviscerate
[finish]
Fluffy_Pillow 185.9/200 93% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, symbolic_victory, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:22.220Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:23.225Hgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:24.231Sshadow_dance
[stealth_cds]
Lycrow 171.9/200 86% energy
5.0/6 83% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:24.231Dgloomblade
[build]
Fluffy_Pillow 171.9/200 86% energy
5.0/6 83% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:25.235Icold_blood
[cds]
Lycrow 159.8/200 80% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:25.235Osecret_technique
[finish]
Fluffy_Pillow 159.8/200 80% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), cold_blood, clear_the_witnesses, shadow_techniques(2), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:26.239Eshadowstrike
[build]
Fluffy_Pillow 187.2/200 94% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:27.245Qeviscerate
[finish]
Fluffy_Pillow 156.4/200 78% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:28.248Gshadowstrike
[build]
Fluffy_Pillow 165.0/200 83% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques, flagellation_persist(30), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:29.252Gshadowstrike
[build]
Fluffy_Pillow 148.2/200 74% energy
4.0/6 67% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:30.259Qeviscerate
[finish]
Fluffy_Pillow 131.4/200 66% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_crit
3:31.263Gshadowstrike
[build]
Fluffy_Pillow 180.0/200 90% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:32.269Qeviscerate
[finish]
Fluffy_Pillow 149.2/200 75% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:33.273Hgloomblade
[build]
Fluffy_Pillow 170.1/200 85% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(3), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:34.278Fshuriken_storm
[build]
Fluffy_Pillow 156.0/200 78% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:35.283Qeviscerate
[finish]
Fluffy_Pillow 122.9/200 61% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:36.288Hgloomblade
[build]
Fluffy_Pillow 136.8/200 68% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques(3), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:37.292Hgloomblade
[build]
Fluffy_Pillow 108.7/200 54% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:38.295Hgloomblade
[build]
Fluffy_Pillow 87.6/200 44% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:39.299Prupture
[finish]
Fluffy_Pillow 66.5/200 33% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:40.303Hgloomblade
[build]
Fluffy_Pillow 83.4/200 42% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:41.305Hgloomblade
[build]
Fluffy_Pillow 55.3/200 28% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:42.899Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:44.671Qeviscerate
[finish]
Fluffy_Pillow 36.2/200 18% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:45.675Ksymbols_of_death
[cds]
Lycrow 83.1/200 42% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:45.675Hgloomblade
[build]
Fluffy_Pillow 123.1/200 62% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(2), the_rotten(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:46.679Hgloomblade
[build]
Fluffy_Pillow 109.0/200 54% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), darkest_night, symbolic_victory, shadow_techniques(2), the_rotten, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:47.684Qeviscerate
[finish]
Fluffy_Pillow 80.9/200 40% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), darkest_night, symbolic_victory, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:48.688Hgloomblade
[build]
Fluffy_Pillow 101.8/200 51% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:49.692Hgloomblade
[build]
Fluffy_Pillow 87.7/200 44% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:50.697Qeviscerate
[finish]
Fluffy_Pillow 73.6/200 37% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:51.703Hgloomblade
[build]
Fluffy_Pillow 94.5/200 47% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:52.707Hgloomblade
[build]
Fluffy_Pillow 66.4/200 33% energy
5.0/6 83% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:53.712Qeviscerate
[finish]
Fluffy_Pillow 38.3/200 19% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:54.717Hgloomblade
[build]
Fluffy_Pillow 59.2/200 30% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:56.567Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
3.0/6 50% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:58.761Hgloomblade
[build]
Fluffy_Pillow 55.2/200 28% energy
4.0/6 67% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:59.767Qeviscerate
[finish]
Fluffy_Pillow 41.1/200 21% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), shadow_techniques(5), deeper_daggers, stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
4:00.770Hgloomblade
[build]
Fluffy_Pillow 88.0/200 44% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques(5), deeper_daggers, stance__surekian_decimation, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_vers
4:01.774Ruse_items
[item]
Fluffy_Pillow 60.3/200 30% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deeper_daggers, stance__surekian_decimation, surekian_grace, now_is_the_time, flask_of_alchemical_chaos_haste
4:01.774Qeviscerate
[finish]
Fluffy_Pillow 60.3/200 30% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:02.776Fshuriken_storm
[build]
Fluffy_Pillow 67.8/200 34% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:03.780Hgloomblade
[build]
Fluffy_Pillow 42.2/200 21% energy
2.0/6 33% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:05.789Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:08.039Prupture
[finish]
Fluffy_Pillow 36.2/200 18% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:09.043Hgloomblade
[build]
Fluffy_Pillow 153.7/200 77% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, now_is_the_time, flask_of_alchemical_chaos_haste
4:10.047Hgloomblade
[build]
Fluffy_Pillow 133.2/200 67% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, momentum_of_despair, shadow_techniques, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:11.051Hgloomblade
[build]
Fluffy_Pillow 112.7/200 56% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, momentum_of_despair, shadow_techniques, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:12.053Qeviscerate
[finish]
Fluffy_Pillow 85.2/200 43% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, momentum_of_despair, shadow_techniques, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:13.057Hgloomblade
[build]
Fluffy_Pillow 99.7/200 50% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), thistle_tea, deathstalkers_mark_buff, momentum_of_despair, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:14.062Hgloomblade
[build]
Fluffy_Pillow 72.2/200 36% energy
3.0/6 50% CP
slice_and_dice, acrobatic_strikes(10), momentum_of_despair, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:15.067Hgloomblade
[build]
Fluffy_Pillow 44.7/200 22% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:16.880Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
5.0/6 83% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:19.130Qeviscerate
[finish]
Fluffy_Pillow 36.2/200 18% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(3), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:20.134Tvanish
[stealth_cds]
Lycrow 83.7/200 42% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques(3), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:20.134Eshadowstrike
[build]
Fluffy_Pillow 83.7/200 42% energy
0.0/6 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques(3), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:21.140Qeviscerate
[finish]
Fluffy_Pillow 60.5/200 30% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, darkest_night, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:22.144Eshadowstrike
[build]
Fluffy_Pillow 68.0/200 34% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:23.149Hgloomblade
[build]
Fluffy_Pillow 42.5/200 21% energy
4.0/6 67% CP
slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:25.798Hgloomblade
[build]
Fluffy_Pillow 42.4/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), subterfuge, clear_the_witnesses, shadow_techniques, deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:28.353Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:31.005Fshuriken_storm
[build]
Fluffy_Pillow 48.2/200 24% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(4), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:33.497Hgloomblade
[build]
Fluffy_Pillow 41.2/200 21% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(5), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:35.619Nflagellation
[cds]
Fluffy_Pillow 27.6/200 14% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(5), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:36.623Prupture
[finish]
Fluffy_Pillow 47.1/200 24% energy
6.0/6 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(6), flagellation_buff, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:37.628Ksymbols_of_death
[cds]
Lycrow 64.6/200 32% energy
0.0/6 0% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, shadow_techniques(6), flagellation_buff(7), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:37.628Sshadow_dance
[stealth_cds]
Lycrow 104.6/200 52% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:37.628Lshadow_blades
[cds]
Lycrow 104.6/200 52% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:37.628Dgloomblade
[build]
Fluffy_Pillow 104.6/200 52% energy
0.0/6 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(6), the_rotten(2), flagellation_buff(7), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:38.634Osecret_technique
[finish]
Fluffy_Pillow 93.2/200 47% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), symbolic_victory, shadow_techniques(8), the_rotten, flagellation_buff(7), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:39.640Qeviscerate
[finish]
Fluffy_Pillow 107.2/200 54% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), deathstalkers_mark_buff, symbolic_victory, shadow_techniques(2), the_rotten, flagellation_buff(13), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:40.644Eshadowstrike
[build]
Fluffy_Pillow 170.4/200 85% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, shadow_techniques(4), the_rotten, flagellation_buff(19), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:41.649Qeviscerate
[finish]
Fluffy_Pillow 168.2/200 84% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(8), flagellation_buff(19), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:42.654Qeviscerate
[finish]
Fluffy_Pillow 177.4/200 89% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), flagellation_buff(25), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:43.657Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:44.663Qeviscerate
[finish]
Fluffy_Pillow 183.8/200 92% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(6), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:45.666Ksymbols_of_death
[cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:45.666Sshadow_dance
[stealth_cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:45.666Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, symbolic_victory, shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:46.671Dgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:47.674Qeviscerate
[finish]
Fluffy_Pillow 188.5/200 94% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:48.679Qeviscerate
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:49.685Eshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:50.688Qeviscerate
[finish]
Fluffy_Pillow 183.7/200 92% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(6), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:51.693Icold_blood
[cds]
Lycrow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:51.693Osecret_technique
[finish]
Fluffy_Pillow 200.0/200 100% energy
6.0/6 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), cold_blood, clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:52.699Gshadowstrike
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, shadow_techniques(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:53.704Qeviscerate
[finish]
Fluffy_Pillow 183.8/200 92% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, darkest_night, shadow_techniques(4), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:54.709Hgloomblade
[build]
Fluffy_Pillow 200.0/200 100% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(6), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:55.714Qeviscerate
[finish]
Fluffy_Pillow 172.5/200 86% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:56.717Hgloomblade
[build]
Fluffy_Pillow 194.0/200 97% energy
0.0/6 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, shadow_techniques(3), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:57.722Hgloomblade
[build]
Fluffy_Pillow 166.5/200 83% energy
4.0/6 67% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:58.726Hgloomblade
[build]
Fluffy_Pillow 153.0/200 76% energy
5.0/6 83% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), flagellation_persist(30), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:59.730Qeviscerate
[finish]
Fluffy_Pillow 125.5/200 63% energy
6.0/6 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), clear_the_witnesses, shadow_techniques(2), deeper_daggers, surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470503234908629102 (24294)
Stamina864520272446259473173021
Intellect12000012360120000
Spirit00000
Health544892051894600
Energy2002000
Combo Points660
Spell Power12360120000
Crit30.41%30.41%12886
Haste7.30%7.75%5113
Versatility14.96%7.42%5785
Attack Power5382450024938
Mastery49.79%45.92%7521
Armor227652276522765
Run Speed80215
Leech4.00%4.00%1020

Gear

Source Slot Average Item Level: 615.00
Local Head Lockstitch Headgear of the Harmonious (lockstitch_headgear)
ilevel: 662, stats: { 3,844 Armor, +32,645 Sta, +4,701 AgiInt, +798 Mastery, +1,436 Vers }
Local Neck Gold-Thread Choker
ilevel: 606, stats: { +8,601 Sta, +2,771 Crit, +1,960 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 619, stats: { 2,701 Armor, +13,812 Sta, +900 Vers, +481 Mastery, +2,362 AgiInt }
Local Shirt Lucky Shirt
ilevel: 1
Local Chest Lockstitch Vest of the Fireflash (lockstitch_vest)
ilevel: 593, stats: { 3,406 Armor, +12,583 Sta, +2,472 AgiInt, +1,145 Crit, +458 Haste }, enchant: { +440 Agi, +215 RunSpeed (stormriders_agility_2) }
Local Waist Myconic Strap
ilevel: 610, stats: { 2,100 Armor, +12,149 Sta, +801 Crit, +518 Vers, +2,172 AgiInt }
Local Legs Treasure-Seeker's Breeches
ilevel: 606, stats: { 3,195 Armor, +15,291 Sta, +787 Haste, +934 Mastery, +2,790 AgiInt }, enchant: { +980 BonusArmor, +930 StrAgi (defenders_armor_kit_3) }
Local Feet Treasure-Seeker's Boots
ilevel: 606, stats: { 2,282 Armor, +11,469 Sta, +563 Crit, +729 Mastery, +2,093 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Treasure-Seeker's Bindings
ilevel: 606, stats: { 1,826 Armor, +8,601 Sta, +526 Haste, +443 Mastery, +1,569 AgiInt }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
Local Hands Lockstitch Grips of the Quickblade (lockstitch_grips)
ilevel: 593, stats: { 1,916 Armor, +9,438 Sta, +1,854 AgiInt, +343 Crit, +858 Vers }
Local Finger1 Band of the Ancient Dredger
ilevel: 606, stats: { +8,601 Sta, +2,487 Crit, +2,244 Haste }, enchant: { +190 Crit (glimmering_critical_strike_3) }
Local Finger2 Umbriss Band
ilevel: 606, stats: { +8,601 Sta, +1,419 Crit, +3,311 Mastery }, enchant: { +190 Crit (glimmering_critical_strike_3) }
Local Trinket1 Sikran's Endless Arsenal
ilevel: 606, stats: { +2,652 StrAgi }
item effects: { equip: Sikran's Endless Arsenal, use: Sikran's Endless Arsenal }
Local Trinket2 Mithril Wristwatch
ilevel: 655, stats: { +1,550 Crit }
item effects: { equip: Now is the Time! }
Local Back Royal Emblem of Nerub-ar
ilevel: 610, stats: { 1,495 Armor, +9,112 Sta, +311 Crit, +678 Mastery, +1,629 StrAgiInt }, enchant: { +1,020 Leech (chant_of_leeching_fangs_3) }
Local Main Hand Direbrew's Bloodied Shanker
ilevel: 655, weapon: { 3,379 - 5,633, 1.8 }, stats: { +2,202 Agi, +14,931 Sta, +583 Crit, +477 Haste }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Splice 'n Dice
ilevel: 593, weapon: { 1,896 - 3,162, 1.8 }, stats: { +1,236 Agi, +6,292 Sta, +280 Crit, +521 Haste }, enchant: authority_of_the_depths_2, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Lycrow"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/lycrow"
spec=subtlety
level=80
race=human
role=attack
position=back
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAMAAAAAAAzyMzsMZwMjZmxYGmZGzMjZbWGGbbzMjZYwYmlZbAAAAYGMsY2mxsNDjFGWmZbahWmFmZA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_use_buff&(!trinket.1.has_use_buff|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|buff.darkest_night.up|variable.targets>=4&(!talent.replicating_shadows&talent.unseen_blade|raid_event.adds.up)
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&(buff.slice_and_dice.up|variable.targets<=2)
actions+=/variable,name=secret,value=buff.shadow_dance.up&!buff.darkest_night.up|(cooldown.flagellation.remains<60&cooldown.flagellation.remains>30&talent.death_perception&talent.unseen_blade)
actions+=/variable,name=racial_sync,value=(buff.shadow_blades.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=race
actions+=/call_action_list,name=item
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend|action.coup_de_grace.ready&cooldown.secret_technique.remains>0
actions+=/call_action_list,name=build
actions+=/call_action_list,name=fill,if=!variable.stealth

actions.build=backstab,if=(talent.unseen_blade|variable.targets<=2)&(buff.shadow_dance.up&(buff.premeditation.up|buff.shadow_blades.up)&!used_for_danse|!variable.stealth&buff.shadow_blades.up)
actions.build+=/gloomblade,if=buff.shadow_dance.up&!used_for_danse|!variable.stealth&buff.shadow_blades.up
actions.build+=/shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=3
actions.build+=/shuriken_tornado,if=talent.unseen_blade&!buff.stealth.up&((buff.shadow_dance.up&!talent.shadowcraft&variable.targets>=3)|(talent.shadowcraft&variable.targets>=3)|!variable.stealth&variable.targets<=2)&(buff.symbols_of_death.up|!raid_event.adds.up)
actions.build+=/shuriken_storm,if=buff.clear_the_witnesses.up&(variable.targets>=2|!buff.symbols_of_death.up)
actions.build+=/shadowstrike,cycle_targets=1,if=talent.deathstalkers_mark&!debuff.deathstalkers_mark.up&variable.targets>=3&(buff.shadow_blades.up|buff.premeditation.up|talent.the_rotten)
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&variable.targets>=(2+3*buff.shadow_dance.up)
actions.build+=/shuriken_storm,if=talent.unseen_blade&(buff.flawless_form.up&variable.targets>=3&!variable.stealth|buff.silent_storm.up&variable.targets>=5&buff.shadow_dance.up)
actions.build+=/shuriken_storm,if=(buff.tww3_trickster_4pc.up|buff.escalating_blade.stack=4)&!used_for_danse&(buff.shadow_blades.up|variable.targets>=4)
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&(buff.flagellation_persist.up|buff.flagellation_buff.remains<=3)
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3.5&variable.maintenance&(variable.targets>1|raid_event.adds.up|!buff.flagellation_buff.up|dot.rupture.remains>=30)&(!talent.flagellation|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>4&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5&cooldown.shadow_blades.remains<=3|fight_remains<=25

actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable|buff.flagellation_buff.up&!buff.symbols_of_death.up&variable.targets<=2)&target.time_to_die-remains>6&cooldown.flagellation.remains>=10
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
actions.finish+=/coup_de_grace,if=debuff.fazed.up&cooldown.flagellation.remains>=20|fight_remains<=10
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&(((variable.targets>=2&talent.deathstalkers_mark&(!buff.darkest_night.up|buff.shadow_dance.up&variable.targets>=5))|talent.unseen_blade&variable.targets>=4)|action.coup_de_grace.ready&variable.targets>=3)
actions.finish+=/eviscerate,if=cooldown.flagellation.remains>=10|variable.targets>=3

actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=cursed_stone_idol,use_off_gcd=1,if=dot.rupture.remains>=25&buff.flagellation_buff.up|fight_remains<=20
actions.item+=/use_item,name=unyielding_netherprism,use_off_gcd=1,if=buff.shadow_blades.up&(buff.latent_energy.stack>=8+8*(trinket.arazs_ritual_forge.cooldown.ready|!equipped.arazs_ritual_forge)|!equipped.arazs_ritual_forge&fight_remains<=90)|fight_remains<=20
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

actions.stealth_cds=shadow_dance,if=(variable.shd_cp|!talent.premeditation)&variable.maintenance&(cooldown.secret_technique.remains<=24|talent.the_first_dance&buff.shadow_blades.up)&(buff.symbols_of_death.remains>=6|buff.shadow_blades.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=lockstitch_headgear,id=224677,bonus_id=12276/6652/12921/12244/1716/3191/10254
neck=goldthread_choker,id=219217,bonus_id=6652/10395/10392/10270/3185/10255
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10369/6652/10262/1520/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=6652/10379/10355/10265/1511/10255,enchant=chant_of_leeching_fangs_3
chest=lockstitch_vest,id=224674,bonus_id=6652/1690/10377/10278/1665/10255,enchant=stormriders_agility_2
shirt=lucky_shirt,id=138385
wrists=treasureseekers_bindings,id=211020,bonus_id=6652/10876/10377/10270/3185/10255,enchant=chant_of_armored_avoidance_3
hands=lockstitch_grips,id=224676,bonus_id=6652/1682/10377/10278/1665/10255
waist=myconic_strap,id=219168,bonus_id=10265/6652/10397/10377/3189/10255
legs=treasureseekers_breeches,id=211018,bonus_id=6652/10377/10270/3185/10255,enchant=defenders_armor_kit_3
feet=treasureseekers_boots,id=211015,bonus_id=6652/10377/10270/3185/10255,enchant=defenders_march_3
finger1=band_of_the_ancient_dredger,id=159461,bonus_id=10389/6652/10395/10392/10383/10274/10014/10255,enchant=glimmering_critical_strike_3
finger2=umbriss_band,id=133286,bonus_id=10389/6652/10395/10393/10383/10274/10036/10255,enchant=glimmering_critical_strike_3
trinket1=sikrans_endless_arsenal,id=212449,bonus_id=6652/10354/10270/1507/10255
trinket2=mithril_wristwatch,id=117358,bonus_id=12274/11351/10254
main_hand=direbrews_bloodied_shanker,id=117378,bonus_id=12274/11351/10254
off_hand=splice_n_dice,id=221183,bonus_id=10388/6652/10290/1628/10255,enchant=authority_of_the_depths_2

# Gear Summary
# gear_ilvl=614.50
# gear_agility=29102
# gear_stamina=173021
# gear_attack_power=938
# gear_crit_rating=12633
# gear_haste_rating=5013
# gear_mastery_rating=7374
# gear_versatility_rating=5672
# gear_leech_rating=1020
# gear_speed_rating=215
# gear_avoidance_rating=1090
# gear_armor=22765

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 74109184
Max Event Queue: 162
Sim Seconds: 3007013
CPU Seconds: 135.2175
Physical Seconds: 29.7131
Speed Up: 22238

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health1,016,315.70.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Trigger CountInterval
Dynamic Buffs Start Refresh Total Start Trigger Duration Uptime Benefit Overflow Expiry
Corrupt the Blood1.0176.5177.53.0s1.7s297.0s98.98%0.00%167.5 (167.5)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_corrupt_the_blood
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 3.0s
  • trigger_min/max:0.0s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:237.0s / 357.0s
  • uptime_min/max:98.74% / 99.16%

Stack Uptimes

  • corrupt_the_blood_1:0.46%
  • corrupt_the_blood_2:0.42%
  • corrupt_the_blood_3:0.12%
  • corrupt_the_blood_4:0.38%
  • corrupt_the_blood_5:0.46%
  • corrupt_the_blood_6:0.46%
  • corrupt_the_blood_7:0.46%
  • corrupt_the_blood_8:0.46%
  • corrupt_the_blood_9:0.46%
  • corrupt_the_blood_10:95.30%

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deathstalker's Mark27.20.027.211.2s11.3s8.8s79.32%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 40.1s
  • trigger_min/max:4.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.5s
  • uptime_min/max:67.31% / 86.83%

Stack Uptimes

  • deathstalkers_mark_1:24.42%
  • deathstalkers_mark_2:25.25%
  • deathstalkers_mark_3:29.65%

Spelldata

  • id:457129
  • name:Deathstalker's Mark
  • tooltip:Marked by {$@=}auracaster, suffering additional Plague damage from their abilities.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Fatal Intent1.042.943.95.1s5.4s239.8s79.94%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_fatal_intent
  • max_stacks:999
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.1s
  • trigger_min/max:1.0s / 35.6s
  • trigger_pct:100.00%
  • duration_min/max:177.0s / 303.0s
  • uptime_min/max:70.49% / 86.58%

Stack Uptimes

  • fatal_intent_1:1.59%
  • fatal_intent_2:1.65%
  • fatal_intent_3:1.62%
  • fatal_intent_4:1.62%
  • fatal_intent_5:1.60%
  • fatal_intent_6:1.59%
  • fatal_intent_7:1.63%
  • fatal_intent_8:1.69%
  • fatal_intent_9:1.73%
  • fatal_intent_10:1.78%
  • fatal_intent_11:1.82%
  • fatal_intent_12:1.85%
  • fatal_intent_13:1.87%
  • fatal_intent_14:1.87%
  • fatal_intent_15:1.89%
  • fatal_intent_16:1.90%
  • fatal_intent_17:1.92%
  • fatal_intent_18:1.93%
  • fatal_intent_19:1.91%
  • fatal_intent_20:1.94%
  • fatal_intent_21:1.94%
  • fatal_intent_22:1.93%
  • fatal_intent_23:1.89%
  • fatal_intent_24:1.87%
  • fatal_intent_25:1.87%
  • fatal_intent_26:1.87%
  • fatal_intent_27:1.89%
  • fatal_intent_28:1.88%
  • fatal_intent_29:1.90%
  • fatal_intent_30:1.89%
  • fatal_intent_31:1.88%
  • fatal_intent_32:1.89%
  • fatal_intent_33:1.80%
  • fatal_intent_34:1.79%
  • fatal_intent_35:1.73%
  • fatal_intent_36:1.71%
  • fatal_intent_37:1.60%
  • fatal_intent_38:1.51%
  • fatal_intent_39:1.42%
  • fatal_intent_40:1.33%
  • fatal_intent_41:1.21%
  • fatal_intent_42:1.13%
  • fatal_intent_43:1.00%
  • fatal_intent_44:0.90%
  • fatal_intent_45:0.78%
  • fatal_intent_46:0.70%
  • fatal_intent_47:0.61%
  • fatal_intent_48:0.53%
  • fatal_intent_49:0.45%
  • fatal_intent_50:0.37%
  • fatal_intent_51:0.31%
  • fatal_intent_52:0.25%
  • fatal_intent_53:0.20%
  • fatal_intent_54:0.16%
  • fatal_intent_55:0.13%
  • fatal_intent_56:0.10%
  • fatal_intent_57:0.08%
  • fatal_intent_58:0.06%
  • fatal_intent_59:0.05%
  • fatal_intent_60:0.04%
  • fatal_intent_61:0.03%
  • fatal_intent_62:0.02%
  • fatal_intent_63:0.02%
  • fatal_intent_64:0.03%
  • fatal_intent_65:0.02%
  • fatal_intent_66:0.02%
  • fatal_intent_67:0.01%
  • fatal_intent_68:0.05%

Spelldata

  • id:461981
  • name:Fatal Intent
  • tooltip:Falling below {$461980=}M~3% health will cause Fatal Intent to inflict {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage.
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}
  • max_stacks:999
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Find Weakness2.2110.1112.3127.0s2.7s134.3s99.06%98.90%110.1 (110.1)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 354.1s
  • trigger_min/max:0.9s / 33.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 360.0s
  • uptime_min/max:89.77% / 100.00%

Stack Uptimes

  • find_weakness_1:99.06%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.03.791.5s91.6s11.8s14.61%22.61%0.0 (0.0)3.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:2.0s / 95.7s
  • trigger_min/max:90.0s / 95.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.74%

Stack Uptimes

  • flagellation_1:14.61%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=10}/10*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 1027248.17
Minimum 941045.05
Maximum 1120573.14
Spread ( max - min ) 179528.09
Range [ ( max - min ) / 2 * 100% ] 8.74%
Standard Deviation 23855.5802
5th Percentile 989079.78
95th Percentile 1067357.81
( 95th Percentile - 5th Percentile ) 78278.03
Mean Distribution
Standard Deviation 238.5677
95.00% Confidence Interval ( 1026780.58 - 1027715.75 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2072
0.1 Scale Factor Error with Delta=300 4858069
0.05 Scale Factor Error with Delta=300 19432275
0.01 Scale Factor Error with Delta=300 485806853
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health02487274930
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Total Time

Time spent on executing the ability. Includes cast times, gcd times, and channel times.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.