SimulationCraft 1125-01      berechnet von Metaux@Antonidas

for World of Warcraft 11.2.5.63906 Live (hotfix 2025-10-21/63906, git build a5a05f01e9)

Current simulator hotfixes

Demon Hunter

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
213243Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
178963Consume Soul prj_speed 25.00 0.00

Druid

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
Balance Druid aura does not increase Regrowth cost
260777Balance Druid (effect#6) base_value 0.00 47.00

Evoker

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
1035393Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-06-28 Manually set Arcane Orb's travel speed.
153626Arcane Orb prj_speed 30.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
30455Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
84714Frozen Orb prj_speed 20.00 0.00

Monk

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#2).
1233895Monk Shado-Pan 11.2 Class Set 4pc (effect#2) base_value 120.00 150.00
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#1).
1232299Monk Shado-Pan 11.2 Class Set 4pc (effect#1) base_value 100.00 50.00
2025-08-03 Manually revert TWW3-SPM-2p hotfixes (effect#3).
1233833Monk Shado-Pan 11.2 Class Set 2pc (effect#3) base_value 100.00 70.00

Rogue

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2025-07-29 Fatebound Lucky Coin Expiry
1156957Fateful Ending (effect#2) base_value 15.00 10.00

Shaman

Tag / ID Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
191634Stormkeeper max_stack 3.00 0.00

Nêphôr : 3,790,192 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
3,790,192.53,790,192.52,846.0 / 0.075%568,889.8 / 15.0%351,981.7
Resource Out In Waiting APM Active
Astral Power10.810.90.00%56.7100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/n%C3%AAph%C3%B4r
TalentCYGAkuH5GdQpDrgY32rlVGnyqBAAAAAAAAAAAAAAAAAALUmtGGzMAzCLzMzCDjFzyMLzMbzMzMzMLmlxwgNswAMW2mZDjZbEYKAAEALmZMAbGzYA
Set Bonus
Scale Factors for Nêphôr Damage Per Second
Haste Mastery Vers Crit Int
Scale Factors 49.47 47.62 46.89 42.05 32.90
Normalized 1.50 1.45 1.42 1.28 1.00
Scale Deltas 2310 2310 2310 2310 2310
Error 1.76 1.77 1.76 1.77 1.76
Ranking
  • Haste > Mastery ~= Vers > Crit > Int
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, Intellect=32.90, CritRating=42.05, HasteRating=49.47, MasteryRating=47.62, Versatility=46.89 )

Scale Factors for other metrics

Scale Factors for Nêphôr Priority Target Damage Per Second
Haste Mastery Vers Crit Int
Scale Factors 49.47 47.62 46.89 42.05 32.90
Normalized 1.50 1.45 1.42 1.28 1.00
Scale Deltas 2310 2310 2310 2310 2310
Error 1.76 1.77 1.76 1.77 1.76
Ranking
  • Haste > Mastery ~= Vers > Crit > Int
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, Intellect=32.90, CritRating=42.05, HasteRating=49.47, MasteryRating=47.62, Versatility=46.89 )
Scale Factors for Nêphôr Damage Per Second (Effective)
Haste Mastery Vers Crit Int
Scale Factors 49.47 47.62 46.89 42.05 32.90
Normalized 1.50 1.45 1.42 1.28 1.00
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Mastery > Vers > Crit > Int
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, Intellect=32.90, CritRating=42.05, HasteRating=49.47, MasteryRating=47.62, Versatility=46.89 )
Scale Factors for Nêphôr Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, )
Scale Factors for Nêphôr Fight Length
Haste Vers Crit Int Mastery
Scale Factors -0.00 -0.00 -0.00 -0.00 0.00
Normalized 3440.78 51.58 49.50 1.00 -3322.50
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Vers > Crit > Int > Mastery
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, Intellect=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00 )
Scale Factors for Raid Damage Per Second
Haste Mastery Vers Crit Int
Scale Factors 49.47 47.62 46.89 42.05 32.90
Normalized 1.50 1.45 1.42 1.28 1.00
Scale Deltas 2310 2310 2310 2310 2310
Error 1.76 1.77 1.76 1.77 1.76
Ranking
  • Haste > Mastery ~= Vers > Crit > Int
Pawn string ( Pawn: v1: "Nêphôr-Balance": Class=Druid, Spec=Balance, Intellect=32.90, CritRating=42.05, HasteRating=49.47, MasteryRating=47.62, Versatility=46.89 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval Total Time DPE DPET Type Count Hit Crit Avg Crit% Up%
Nêphôr3,790,192
Astral Smolder 273,0717.2%47.76.31s0.0s1,714,5800Periodic104.3784,4950784,4950.0%69.6%

Stats Details: Astral Smolder

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage47.730.00104.33104.3330.200.00002.000081,843,694.5681,843,694.560.00%392,234.710.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%104.3352152784,494.8365,8166,391,793783,936.79400,9171,361,43181,843,69581,843,6950.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your Starfire and Wrath damage has a {$h=35}% chance to cause the target to languish for an additional {$s1=60}% of your spell's damage over {$394061d=6 seconds}.}

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Snapshots Eclipse (Lunar)4851870.0%Current Value
Eclipse (Solar)4851780.0%Current Value
Azhiccaran Mite 22,1060.6%11.124.71s0.0s598,8180Periodic81.769,709139,51181,22016.5%17.1%

Stats Details: Azhiccaran Mite

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.080.0081.7081.701.640.00000.62626,635,207.206,635,207.200.00%129,692.680.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit83.51%68.231814669,708.669282,15569,647.0063,32676,9234,755,9724,755,9720.00%
crit16.49%13.47140139,511.22190164,310139,366.7723,244163,3351,879,2351,879,2350.00%

Action Details: Azhiccaran Mite

  • id:1243828
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:66553.58
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:1243828
  • name:Azhiccaran Mite
  • school:physical
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=1} sec.
  • description:{$@spelldesc1243818=Your damaging spells have a chance to attract mites to feast on your target, inflicting up to {$=}{{$s1=17776}*{$1243828d=5 seconds}/{$1243828t1=1}} Shadow damage over {$1243828d=5 seconds}. Well-fed mites share their meal with you, each increasing your Intellect by {$s2=2210} for {$1243843d=30 seconds}.}
Ethereal Reaping 120,9383.2%16.816.94s0.0s2,165,0970Direct16.81,858,3243,718,9552,164,97416.5%

Stats Details: Ethereal Reaping

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.7616.760.000.000.000.00000.000036,279,613.4236,279,613.420.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.51%13.994321,858,324.151,687,1752,228,5591,857,979.521,706,4402,025,32426,005,38626,005,3860.00%
crit16.49%2.760123,718,955.243,374,3504,457,1173,497,680.6204,457,11710,274,22810,274,2280.00%

Action Details: Ethereal Reaping

  • id:1223417
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1588366.68
  • base_dd_max:1588366.68
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:1223417
  • name:Ethereal Reaping
  • school:arcane
  • tooltip:
  • description:{$@spelldesc1217101=Your harmful spells and abilities have a chance to focus latent energies around you to inflict {$1217091s1=149802} Arcane damage split between your target and nearby enemies. Enemies below {$1217091s4=35}% health take {$1217091s5=20}% additional damage.}
Fury of Elune 332,211 (389,162)8.8% (10.3%)15.719.57s16.2s / 5.4%7,407,7987,195,788Direct373.3195,951416,124266,56332.1%

Stats Details: Fury Of Elune

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.74373.310.000.000.001.02950.000099,511,179.5599,511,179.550.00%7,195,788.157,195,788.15
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.93%253.58176340195,951.23118,253335,461195,923.35180,290213,28449,689,23249,689,2320.00%
crit32.07%119.7375174416,123.64228,467670,168416,239.95378,477458,14149,821,94849,821,9480.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:2.5

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:{$?a137010=false}[Generating {$=}{{$m4=30}/{$t4=0.500}*{$d=8 seconds}} Rage over {$d=8 seconds}.][Generating {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.]
  • description:{$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:100.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:1.00

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770={$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]}

Action Priority List

    st
    [I]:3.22
  • if_expr:(cooldown.ca_inc.remains<?variable.eclipse_remains)<gcd.max|cooldown.ca_inc.remains<fight_remains&fight_remains<(buff.ca_inc.duration+gcd.max>?fight_remains-cooldown.ca_inc.remains)+gcd.max|fight_remains<8+gcd.max
    st
    [N]:12.52
  • if_expr:5+variable.passive_asp<astral_power.deficit&(!(cooldown.ca_inc.remains<variable.eclipse_remains&variable.eclipse_remains<12)|buff.dreamstate.up&cooldown.ca_inc.remains<gcd.max)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownRadiant Moonlight3941211ADD-15000.000
Spell Direct AmountRadiant Moonlight3941213PCT50.0%
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery, DISABLED
Sunfire16481540.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
    Boundless Moonlight 56,9511.5%15.319.57s0.0s1,113,7500Direct15.3931,6881,864,4371,113,80819.5%

Stats Details: Fury Of Elune Boundless

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.3415.340.000.000.000.00000.000017,082,175.8917,082,175.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.48%12.34418931,687.58729,8151,319,703931,496.78851,8961,021,86911,500,40511,500,4050.00%
crit19.52%2.990101,864,437.261,459,6302,518,8631,788,182.5902,484,3305,581,7715,581,7710.00%

Action Details: Fury Of Elune Boundless

  • id:428682
  • school:astral
  • range:40.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.277000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:1.00

Spelldata

  • id:428682
  • name:Boundless Moonlight
  • school:astral
  • tooltip:
  • description:{$@spelldesc424058={$?a137010=false}[{$@=}spellicon204066 {$@=}spellname204066 Lunar Beam now causes you to leech life equal to {$425217s1=10}% of all damage dealt to enemies within the beam. {$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage.] [{$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage. {$@=}spellicon274283 {$@=}spellname274283 {$@spelldesc424588={$?a424113=true}[New Moon and Half Moon call down {$s3=1} Minor {$=}LMoon:Moons; and ][]Full Moon calls down {$424058s1=2} Minor {$=}LMoon:Moons; that {$=}Ldeals:deal; {$s1=0} Astral damage and generate {$=}{{$m2=30}/10} Astral Power.}]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountThe Eternal Moon4241131PCT50.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Critical Strike Chance Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Lightning Strike 30,1850.8%52.55.25s0.0s172,4540Direct52.5148,034296,164172,45716.5%

Stats Details: Lightning Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.5452.540.000.000.000.00000.00009,059,904.179,059,904.170.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.51%43.871399148,033.83143,711163,829148,000.37143,711154,7176,494,9446,494,9440.00%
crit16.49%8.66026296,164.45287,423327,659296,116.470327,2262,564,9602,564,9600.00%

Action Details: Lightning Strike

  • id:1236111
  • school:nature
  • range:50000.0
  • travel_speed:0.0000
  • radius:40.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135295.42
  • base_dd_max:135295.42
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:1236111
  • name:Lightning Strike
  • school:nature
  • tooltip:
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
Moonfire 176,488 (288,873)4.7% (7.6%)14.321.61s14.3s / 4.8%6,040,2946,042,457Direct14.3159,716314,548202,89227.9%
Periodic300.5131,773264,804166,42926.1%99.5%

Stats Details: Moonfire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.3414.34300.54300.5413.340.99970.993552,928,423.3452,928,423.340.00%276,861.076,042,457.06
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.11%10.34217159,715.8492,025272,915159,633.28127,505206,5261,651,9951,651,9950.00%
crit27.89%4.00011314,547.60195,094531,465311,009.620514,5561,258,1871,258,1870.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.95%222.25157300131,772.961,618203,142131,751.32121,020142,90529,286,32329,286,3230.00%
crit26.05%78.2944123264,803.83159,372406,938264,849.28239,741292,57020,731,91920,731,9190.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:astral_power
  • energize_amount:8.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 21.2%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.212000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.19
  • base_multiplier:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.184000
  • base_td:0.00
  • base_td_mult:2.19
  • base_multiplier:1.00
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.{$?=}{$=}w8<0[ Movement slowed by {$=}w8%.][]
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 21.2%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [M]:2.51
  • target_if_expr:remains<3&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)
    st
    [U]:11.83
  • target_if_expr:refreshable&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid13701314PCT6.0%
Spell Periodic AmountBalance Druid13701315PCT6.0%
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountLore of the Grove4491851PCT10.0%
Spell Periodic AmountLore of the Grove4491852PCT10.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Tick TimeCosmic Rapidity4000591PCT-25.0%
Spell Direct AmountTwin Moons2796202PCT10.0%
Spell Periodic AmountTwin Moons2796203PCT10.0%
Spell Direct AmountLunar Insight4295301PCT20.0%
Spell Periodic AmountLunar Insight4295302PCT20.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Umbral Inspiration450419130.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Umbral Inspiration450419230.0%Spell Data
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
    The Light of Elune 75,713 (112,385)2.0% (3.0%)10.427.30s0.0s3,251,7730Direct89.5192,698405,430253,72428.7%

Stats Details: The Light Of Elune

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.3789.470.000.000.000.00000.000022,700,437.2022,700,437.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.31%63.8014160192,697.63113,705325,981192,415.40159,928254,98712,294,94112,294,9410.00%
crit28.69%25.67275405,429.67239,444651,963402,596.49319,852555,45110,405,49710,405,4970.00%

Action Details: The Light Of Elune

  • id:202770
  • school:astral
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:2.5

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:{$?a137010=false}[Generating {$=}{{$m4=30}/{$t4=0.500}*{$d=8 seconds}} Rage over {$d=8 seconds}.][Generating {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.]
  • description:{$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]

Action Details: The Light Of Elune Tick

  • id:211545
  • school:astral
  • range:100.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:1.00

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770={$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownRadiant Moonlight3941211ADD-15000.000
Spell Direct AmountRadiant Moonlight3941213PCT50.0%
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery, DISABLED
Sunfire16481540.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
        Boundless Moonlight 36,6731.0%10.327.23s0.0s1,072,3470Direct10.3898,1441,803,8391,072,32419.2%

Stats Details: The Light Of Elune Boundless

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.2710.270.000.000.000.00000.000011,007,888.8111,007,888.810.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.77%8.29122898,143.92729,8151,305,753897,855.63786,8691,067,7247,446,4677,446,4670.00%
crit19.23%1.970101,803,838.861,459,6302,514,7411,555,348.6202,404,1913,561,4223,561,4220.00%

Action Details: The Light Of Elune Boundless

  • id:428682
  • school:astral
  • range:40.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.277000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:1.00

Spelldata

  • id:428682
  • name:Boundless Moonlight
  • school:astral
  • tooltip:
  • description:{$@spelldesc424058={$?a137010=false}[{$@=}spellicon204066 {$@=}spellname204066 Lunar Beam now causes you to leech life equal to {$425217s1=10}% of all damage dealt to enemies within the beam. {$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage.] [{$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage. {$@=}spellicon274283 {$@=}spellname274283 {$@spelldesc424588={$?a424113=true}[New Moon and Half Moon call down {$s3=1} Minor {$=}LMoon:Moons; and ][]Full Moon calls down {$424058s1=2} Minor {$=}LMoon:Moons; that {$=}Ldeals:deal; {$s1=0} Astral damage and generate {$=}{{$m2=30}/10} Astral Power.}]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountThe Eternal Moon4241131PCT50.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Critical Strike Chance Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Shooting Stars 0 (224,530)0.0% (5.9%)0.00.00s0.0s00

Stats Details: Shooting Stars

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-25.0%
    Shooting Stars (Moonfire) 112,0803.0%89.33.34s0.0s376,2760Periodic89.1277,855584,136377,20532.4%0.0%

Stats Details: Shooting Stars Moonfire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage89.280.000.0089.060.000.00000.000033,594,530.8233,594,530.820.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.56%60.173194277,854.93149,878558,545277,861.28242,194319,61216,719,63916,719,6390.00%
crit32.44%28.891252584,136.45299,7561,149,676584,473.07476,261703,84216,874,89216,874,8920.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.381600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.42
  • base_multiplier:1.00

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Umbral Inspiration450419130.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Umbral Inspiration450419230.0%Spell Data
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery
Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
    Shooting Stars (Sunfire) 112,4503.0%89.73.31s0.0s375,9720Periodic89.4277,530583,837376,87432.4%0.0%

Stats Details: Shooting Stars Sunfire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage89.660.000.0089.450.000.00000.000033,711,061.1533,711,061.150.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.57%60.443197277,530.11149,878556,295277,505.12243,894318,95616,773,25216,773,2520.00%
crit32.43%29.011155583,837.47299,7561,094,798584,196.41490,268708,45216,937,81016,937,8100.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.381600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.42
  • base_multiplier:1.00

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Umbral Inspiration450419130.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Umbral Inspiration450419230.0%Spell Data
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery
Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Starfire 518,289 (1,165,855)13.7% (30.8%)80.83.68s105.1s / 35.0%4,326,1213,326,001Direct81.41,400,0042,829,8541,907,95635.5%

Stats Details: Starfire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage80.7981.430.000.000.001.30070.0000155,369,889.87155,369,889.870.00%3,326,001.333,326,001.33
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.47%52.5030811,400,003.64786,2162,214,5911,399,769.341,293,9081,520,77973,503,68573,503,6850.00%
crit35.53%28.9312542,829,854.381,572,4314,300,1762,830,254.172,532,7483,215,62581,866,20581,866,2050.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.10
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:3.88
  • base_multiplier:1.00

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 89.0%} Arcane damage to the target, and {$?a429523=true}[{$=}{({$m1=0}*{$m3=33}/100)/(1+{$429523s1=160}/100)}][{$=}{{$m1=0}*{$m3=33}/100}] Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=80}/10} Astral Power.|r

Action Priority List

    st
    [K]:1.54
  • if_expr:(!variable.enter_lunar|cooldown.ca_inc.remains<cast_time)&eclipse.in_eclipse&variable.eclipse_remains<cast_time
    st
    [Y]:104.38
  • if_expr:talent.lunar_calling

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountStarlight Conduit4512111PCT5.0%
Spell Critical ChanceWild Surges4068901ADD0.100
Spell Direct AmountLunar Calling4295231PCT160.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Eclipse (Lunar)48518515.0%Spell Data
Eclipse (Lunar)48518115.0%Current Value
Druid Elune's Chosen 11.2 Class Set 2pc1236332115.0%Spell DataPassive
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Percent Cast Time Owlkin Frenzy1572281-100.0%Spell Data
Warrior of Elune2024251-100.0%Spell Data
Dreamstate4503461-40.0%Spell DataNo-stacks, Conditional
Percent GCD Dreamstate4503462-40.0%Spell DataNo-stacks, Conditional
Damage on Debuff Moonfire16481240.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
    Starfire (Umbral) 463,34312.2%24.811.64s30.6s / 10.2%5,605,8874,533,703Direct25.14,033,2818,088,1155,525,86236.8%

Stats Details: Starfire Umbral

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage24.7825.140.000.000.001.23650.0000138,912,646.66138,912,646.660.00%4,533,702.574,533,702.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.19%15.883354,033,281.302,436,1126,254,5844,031,582.043,554,3354,654,15964,068,30164,068,3010.00%
crit36.81%9.250228,088,115.234,872,22412,371,8258,086,229.6109,633,39974,844,34674,844,3460.00%

Action Details: Starfire Umbral

  • id:194153
  • school:astral
  • range:40.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.10
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:3.88
  • base_multiplier:1.00

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 89.0%} Arcane damage to the target, and {$?a429523=true}[{$=}{({$m1=0}*{$m3=33}/100)/(1+{$429523s1=160}/100)}][{$=}{{$m1=0}*{$m3=33}/100}] Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=80}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountStarlight Conduit4512111PCT5.0%
Spell Critical ChanceWild Surges4068901ADD0.100
Spell Direct AmountLunar Calling4295231PCT160.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Eclipse (Lunar)48518515.0%Spell Data
Eclipse (Lunar)48518115.0%Current Value
Druid Elune's Chosen 11.2 Class Set 2pc1236332115.0%Spell DataPassive
Moonlight Suffusion123699014.0%Spell Data
Umbral Embrace393763175.0%Spell DataConditional, Manual-entry
Eclipse (Solar)48517115.0%Spell DataConditional
Mastery: Astral Invocation39301430.50000Spell DataMastery, Conditional
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Percent Cast Time Owlkin Frenzy1572281-100.0%Spell Data
Warrior of Elune2024251-100.0%Spell Data
Dreamstate4503461-40.0%Spell DataNo-stacks, Conditional
Percent GCD Dreamstate4503462-40.0%Spell DataNo-stacks, Conditional
Damage on Debuff Moonfire16481240.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Sunfire16481550.25000Mastery
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
    Starsurge (TWW3 Set) 184,2234.9%42.37.01s0.0s1,306,5050Direct42.2994,3052,109,0911,309,85028.3%

Stats Details: Starsurge Tww3

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage42.2742.160.000.000.000.00000.000055,230,313.6355,230,313.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.69%30.23958994,305.47593,2621,750,294993,407.99869,7731,151,57430,053,02030,053,0200.00%
crit28.31%11.941292,109,091.081,186,5253,535,4672,109,039.611,697,1572,716,79125,177,29325,177,2930.00%

Action Details: Starsurge Tww3

  • id:78674
  • school:astral
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.960000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.61
  • base_multiplier:0.45

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountStarlight Conduit4512111PCT5.0%
Spell CooldownStarlight Conduit4512112ADD-4000.000
Spell Direct AmountRattle the Stars3939541PCT8.0%
Spell Resource Cost 1Rattle the Stars3939542PCT-10.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery
Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
Starsurge 901,94823.8%89.73.33s91.4s / 30.5%3,016,1882,960,536Direct89.42,232,5114,623,5973,024,50533.1%

Stats Details: Starsurge

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage89.6889.430.000.000.001.01880.0000270,498,241.10270,498,241.100.00%2,960,535.872,960,535.87
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.87%59.8134852,232,511.121,516,1153,889,5432,231,907.732,049,6122,433,685133,524,002133,524,0020.00%
crit33.13%29.6212504,623,597.103,046,3327,856,5944,625,293.794,068,6975,248,613136,974,239136,974,2390.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.960000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.61
  • base_multiplier:1.00

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [R]:7.38
  • if_expr:variable.cd_condition&astral_power.deficit>variable.passive_asp+action.force_of_nature.energize_amount
    st
    [S]:42.98
  • if_expr:talent.starlord&buff.starlord.stack<3
    st
    [V]:18.39
  • if_expr:cooldown.convoke_the_spirits.remains<gcd.max*2&variable.convoke_condition&astral_power.deficit<50
    st
    [W]:14.56
  • if_expr:buff.starlord.remains>4&variable.boat_stacks>=3|fight_remains<4
    st
    [X]:6.37
  • if_expr:astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max+action.starfire.cast_time))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountStarlight Conduit4512111PCT5.0%
Spell CooldownStarlight Conduit4512112ADD-4000.000
Spell Direct AmountRattle the Stars3939541PCT8.0%
Spell Resource Cost 1Rattle the Stars3939542PCT-10.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery
Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
Suffocating Darkness 37,1041.0%25.211.64s0.0s442,3610Periodic124.689,426089,4260.0%83.0%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.180.00124.57124.5718.650.00002.000011,139,010.1311,139,010.130.00%44,711.100.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%124.577617589,426.3037,180127,15689,073.5952,978112,10311,139,01011,139,0100.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:35002.96
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Sundered Firmament 69,499 (111,841)1.8% (2.9%)11.826.12s0.0s2,847,5330Direct287.450,594105,74072,44739.6%

Stats Details: Sundered Firmament

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.77287.380.000.000.000.00000.000020,819,810.8920,819,810.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.37%173.4912223350,593.8233,67183,86550,588.0346,60555,1498,777,6348,777,6340.00%
crit39.63%113.8869168105,739.5066,248167,731105,744.9695,537117,08012,042,17612,042,1760.00%

Action Details: Sundered Firmament

  • id:394106
  • school:astral
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394106
  • name:Sundered Firmament
  • school:astral
  • tooltip:
  • description:{$@spelldesc394094=Every other Eclipse creates a Fury of Elune at {$s1=25}% effectiveness that follows your current target for {$s2=8} sec.}

Action Details: Sundered Firmament Tick

  • id:394111
  • school:astral
  • range:100.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:0.25

Spelldata

  • id:394111
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770={$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell CooldownRadiant Moonlight3941211ADD-15000.000
Spell Direct AmountRadiant Moonlight3941213PCT50.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301410.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Lunar)48518115.0%Current Value
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301420.50000Spell DataMastery, Passive
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Lunar)48518715.0%Current Value
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39405012.0%Spell Data
Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Moonfire16481240.25000Mastery, DISABLED
Sunfire16481540.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry
    Boundless Moonlight 42,3421.1%11.526.19s0.0s1,105,2850Direct11.5914,4431,834,4481,105,24920.7%

Stats Details: Sundered Firmament Boundless

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.4811.480.000.000.000.00000.000012,691,604.0912,691,604.090.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.26%9.10314914,443.36729,8151,319,703914,384.52819,5421,040,1518,321,9328,321,9320.00%
crit20.74%2.380101,834,447.931,459,6302,570,3311,702,075.7002,437,9454,369,6724,369,6720.00%

Action Details: Sundered Firmament Boundless

  • id:428682
  • school:astral
  • range:100.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.277000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.13
  • base_multiplier:1.00

Spelldata

  • id:428682
  • name:Boundless Moonlight
  • school:astral
  • tooltip:
  • description:{$@spelldesc424058={$?a137010=false}[{$@=}spellicon204066 {$@=}spellname204066 Lunar Beam now causes you to leech life equal to {$425217s1=10}% of all damage dealt to enemies within the beam. {$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage.] [{$@=}spellicon202770 {$@=}spellname202770 Fury of Elune now ends with a flash of energy, blasting nearby enemies for {$428682s1=0} Astral damage. {$@=}spellicon274283 {$@=}spellname274283 {$@spelldesc424588={$?a424113=true}[New Moon and Half Moon call down {$s3=1} Minor {$=}LMoon:Moons; and ][]Full Moon calls down {$424058s1=2} Minor {$=}LMoon:Moons; that {$=}Ldeals:deal; {$s1=0} Astral damage and generate {$=}{{$m2=30}/10} Astral Power.}]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountThe Eternal Moon4241131PCT50.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Critical Strike Chance Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Sunfire 116,7603.1%17.418.06s17.6s / 5.9%2,014,3661,990,932Direct17.4105,127222,158128,08219.6%
Periodic301.588,101185,635108,71521.1%99.8%

Stats Details: Sunfire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage17.3817.38301.54301.5416.381.01180.993235,008,545.0135,008,545.010.00%110,411.281,990,931.81
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.39%13.97521105,126.9465,090198,912105,031.5186,831124,4871,468,6881,468,6880.00%
crit19.61%3.41012222,157.86130,180405,227216,753.120374,913757,246757,2460.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit78.86%237.8117230588,101.2660,368154,14388,101.0380,44096,71320,951,48820,951,4880.00%
crit21.14%63.7333104185,634.85120,736303,191185,735.03164,291213,57611,831,12311,831,1230.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=false}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.212000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.66
  • base_multiplier:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.184000
  • base_td:0.00
  • base_td_mult:1.66
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=false}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [L]:5.93
  • target_if_expr:remains<3|refreshable&(hero_tree.keeper_of_the_grove&cooldown.force_of_nature.ready|hero_tree.elunes_chosen&variable.cd_condition)
    st
    [T]:11.45
  • target_if_expr:refreshable

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountBalance Druid13701312PCT6.0%
Spell Periodic AmountBalance Druid13701313PCT6.0%
Spell Direct AmountLore of the Grove4491851PCT10.0%
Spell Periodic AmountLore of the Grove4491852PCT10.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Tick TimeCosmic Rapidity4000591PCT-25.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Solar)48517115.0%Current Value
Umbral Inspiration450419130.0%Spell Data
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Solar)48517815.0%Current Value
Umbral Inspiration450419230.0%Spell Data
Critical Strike Chance Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Sunfire16481540.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
Sunseeker Mushroom 38,246 (58,028)1.0% (1.5%)9.728.72s0.0s1,800,1180Direct9.6973,6012,040,3071,190,17520.3%

Stats Details: Sunseeker Mushroom

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.689.650.000.000.000.00000.000011,480,962.7811,480,962.780.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.70%7.69121973,601.28715,8271,702,256972,752.31761,5031,274,9517,485,0027,485,0020.00%
crit20.30%1.960102,040,306.591,431,6553,208,0251,762,480.5403,208,0253,995,9613,995,9610.00%

Action Details: Sunseeker Mushroom

  • id:468938
  • school:nature
  • range:50000.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:468938
  • name:Sunseeker Mushroom
  • school:nature
  • tooltip:
  • description:{$@spelldesc468936=Sunfire damage has a chance to grow a magical mushroom at a target's location. After {$468938d=1 second}, the mushroom detonates, dealing {$88751s1=0} Nature damage and then an additional {$81281=}o1 Nature damage over {$81281d=10 seconds}. Affected targets are slowed by {$=}{{$81281s2=50}*-1}%. Generates up to {$88751s2=20} Astral Power based on targets hit. }

Action Details: Sunseeker Mushroom Damage

  • id:88751
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.544000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.42
  • base_multiplier:1.00

Spelldata

  • id:88751
  • name:Wild Mushroom
  • school:nature
  • tooltip:
  • description:{$@spelldesc88747=Grow a magical mushroom at the target enemy's location. After {$d=1 second}, the mushroom detonates, dealing {$88751s1=0} Nature damage and then an additional {$81281=}o1 Nature damage over {$81281d=10 seconds}. Affected targets are slowed by {$=}{{$81281s2=50}*-1}%. Generates up to {$88751s2=20} Astral Power based on targets hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Sunfire16481540.25000Mastery, DISABLED
Waning Twilight39395716.0%DISABLED
Atmospheric Exposure43058916.0%DISABLED
    Fungal Growth 19,7820.5%9.628.71s0.0s615,9110Periodic42.4115,050239,321139,98420.1%28.3%

Stats Details: Fungal Growth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.650.0042.4442.442.370.00002.00005,941,239.135,941,239.130.00%69,997.400.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit79.93%33.92874115,049.6685,601428,274114,499.3193,128171,3123,902,6143,902,6140.00%
crit20.07%8.52026239,321.30171,202856,549236,984.040453,1402,038,6262,038,6260.00%

Action Details: Fungal Growth

  • id:81281
  • school:nature
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.287000
  • base_td:0.00
  • base_td_mult:1.42
  • base_multiplier:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:81281
  • name:Fungal Growth
  • school:nature
  • tooltip:Movement speed reduced by {$s2=50}%. Suffering {$=}w1 Nature damage every {$t1=2} sec.
  • description:{$@spelldesc88751={$@spelldesc88747=Grow a magical mushroom at the target enemy's location. After {$d=1 second}, the mushroom detonates, dealing {$88751s1=0} Nature damage and then an additional {$81281=}o1 Nature damage over {$81281d=10 seconds}. Affected targets are slowed by {$=}{{$81281s2=50}*-1}%. Generates up to {$88751s2=20} Astral Power based on targets hit.}}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Damage on Debuff Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Wrath 49,7931.3%30.39.35s24.5s / 8.2%493,938609,137Direct30.0395,814793,075497,83725.7%

Stats Details: Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.2630.020.000.000.000.81090.000014,947,012.9314,947,012.930.00%609,137.38609,137.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.32%22.311035395,814.38293,293609,728395,543.71357,882436,4868,832,3508,832,3500.00%
crit25.68%7.71018793,074.78586,5861,219,455792,465.9101,062,8856,114,6636,114,6630.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:8.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.060800
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.49
  • base_multiplier:1.00

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [J]:11.40
  • if_expr:variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time&!(cooldown.ca_inc.remains<action.starfire.cast_time)
    st
    [Q]:17.01
  • if_expr:variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT34.0%
Spell Periodic AmountBalance Druid1370132PCT34.0%
Spell Direct AmountNurturing Instinct338731PCT6.0%
Spell Periodic AmountNurturing Instinct338732PCT6.0%
Spell Direct AmountStarlight Conduit4512111PCT5.0%
Spell Critical ChanceWild Surges4068901ADD0.100

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Moonkin Form24858910.0%Spell Data
Circle of the Heavens47454115.0%Spell DataPassive
Lycara's Teachings37898924.0%Spell Data
Mastery: Astral Invocation39301430.50000Spell DataMastery, Passive
Eclipse (Solar)48517260.0%Spell Data
Eclipse (Solar)48517115.0%Current Value
Moonlight Suffusion123699014.0%Spell Data
Periodic Damage Moonkin Form248581010.0%Spell Data
Circle of the Heavens47454125.0%Spell DataPassive
Lycara's Teachings37898934.0%Spell Data
Mastery: Astral Invocation39301440.50000Spell DataMastery, Passive
Eclipse (Solar)48517815.0%Current Value
Critical Strike Chance Balance of All Things39404912.0%Spell Data
Incarnation: Chosen of Elune102560210.0%Spell Data
Percent Cast Time Dreamstate4503461-40.0%Spell DataNo-stacks, Conditional
Percent GCD Eclipse (Solar)485176-15.0%Spell Data
Dreamstate4503462-40.0%Spell DataNo-stacks, Conditional
Damage on Debuff Sunfire16481540.25000Mastery
Waning Twilight39395716.0%
Atmospheric Exposure43058916.0%
Simple Action Stats Execute Interval
Nêphôr
Crystallized Augment Rune 1.00.00s0.0s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêphôr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
reshii_wraps 16.816.93s0.0s

Stats Details: Ethereal Reaping Missile

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.820.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Ethereal Reaping Missile

  • id:1223419
  • school:physical
  • range:100.0
  • travel_speed:35.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1223419
  • name:Ethereal Reaping
  • school:physical
  • tooltip:
  • description:
Flask of Alchemical Chaos 1.00.00s0.0s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêphôr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Midnight Masquerade 1.00.00s0.0s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457285
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêphôr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 4.574.02s0.0s

Stats Details: Incarnation Chosen Of Elune

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.470.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:100.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. {$?a429536=false}[Arcane damage increased by {$=}w6%, haste][Haste] increased by {$=}w1% and critical strike chance by {$=}w2%.
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, {$?a429536=false}[{$s6=10}% increased Arcane damage, ][]and {$s2=10}% critical strike chance. Lasts {$d=20 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [P]:4.47
  • if_expr:variable.cd_condition&(buff.dreamstate.stack=2|prev_gcd.1.fury_of_elune&buff.dreamstate.up|fight_remains<buff.ca_inc.duration+gcd.max)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Modify Cooldown Charge (Category)Whirling Stars4687432SET1.000
Modify Recharge Time (Category)Whirling Stars4687433SET-80000.000
Moonkin Form 1.00.00s0.0s

Stats Details: Moonkin Form

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêphôr
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]{$?=}{$=}w12<0[ Arcane damage taken reduced by {$=}w13% and all other magic damage taken reduced by {$=}w12%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Tempered Potion 1.5300.47s0.0s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [A]:0.25
  • if_expr:fight_remains<=30
    pre_cd
    [G]:1.22
  • if_expr:variable.cd_condition
Warrior of Elune 6.252.57s0.0s

Stats Details: Warrior Of Elune

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.170.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=30}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=30}% increased Astral Power.

Action Priority List

    st
    [H]:6.17
  • if_expr:talent.lunar_calling&!buff.dreamstate.up&(buff.ca_inc.up|cooldown.ca_inc.remains>10|fight_remains<cooldown.ca_inc.remains+5)|!talent.lunar_calling&variable.eclipse_remains<=7

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Snapshots Lunar Amplification43125013.0%Spell DataManual-entry

Buffs

Trigger CountInterval
Dynamic Buffs Start Refresh Total Start Trigger Duration Uptime Benefit Overflow Expiry
Astral Antenna9.24.513.722.5s20.2s12.1s37.08%0.00%0.0 (0.0)8.8

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_astral_antenna
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:5351.86

Trigger Details

  • interval_min/max:0.0s / 103.1s
  • trigger_min/max:0.0s / 90.7s
  • trigger_pct:99.89%
  • duration_min/max:0.0s / 66.4s
  • uptime_min/max:14.84% / 69.35%

Stack Uptimes

  • astral_antenna_1:30.14%
  • astral_antenna_2:6.06%
  • astral_antenna_3:0.79%
  • astral_antenna_4:0.08%
  • astral_antenna_5:0.01%
  • astral_antenna_6:0.00%
  • astral_antenna_7:0.00%

Spelldata

  • id:1239641
  • name:Astral Antenna
  • tooltip:Critical Strike rating increased by {$=}w1.
  • description:{$@spelldesc1234714=The antenna has a chance to detect and draw ambient arcane energy towards you, granting {$s1=5615} Critical Strike for {$1239641d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Astral Antenna (_orb)11.52.514.020.7s20.2s5.5s21.01%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_astral_antenna_orb
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 90.0s
  • trigger_min/max:0.0s / 90.0s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:8.01% / 43.15%

Stack Uptimes

  • astral_antenna_orb_1:19.05%
  • astral_antenna_orb_2:1.84%
  • astral_antenna_orb_3:0.11%
  • astral_antenna_orb_4:0.01%
  • astral_antenna_orb_5:0.00%

Spelldata

  • id:1239640
  • name:Astral Antenna
  • tooltip:The antenna is drawing ambient arcane energy towards you!
  • description:{$@spelldesc1234714=The antenna has a chance to detect and draw ambient arcane energy towards you, granting {$s1=5615} Critical Strike for {$1239641d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Arcane)18.41.119.516.7s16.5s10.0s61.37%0.00%1.1 (8.9)17.8

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:10.0s / 26.6s
  • trigger_min/max:0.1s / 20.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:59.21% / 63.88%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.94%
  • balance_of_all_things_arcane_2:5.96%
  • balance_of_all_things_arcane_3:5.98%
  • balance_of_all_things_arcane_4:6.01%
  • balance_of_all_things_arcane_5:6.03%
  • balance_of_all_things_arcane_6:6.05%
  • balance_of_all_things_arcane_7:6.08%
  • balance_of_all_things_arcane_8:6.35%
  • balance_of_all_things_arcane_9:6.47%
  • balance_of_all_things_arcane_10:6.50%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=10}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature)4.50.04.574.0s74.0s9.9s14.81%0.00%0.0 (0.0)4.4

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:16.0s / 118.3s
  • trigger_min/max:16.0s / 118.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:13.10% / 16.67%

Stack Uptimes

  • balance_of_all_things_nature_1:1.47%
  • balance_of_all_things_nature_2:1.47%
  • balance_of_all_things_nature_3:1.47%
  • balance_of_all_things_nature_4:1.48%
  • balance_of_all_things_nature_5:1.48%
  • balance_of_all_things_nature_6:1.48%
  • balance_of_all_things_nature_7:1.48%
  • balance_of_all_things_nature_8:1.49%
  • balance_of_all_things_nature_9:1.49%
  • balance_of_all_things_nature_10:1.49%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=10}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.01.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Charged Bolts7.15.412.541.9s22.8s20.3s48.12%0.00%45.4 (45.4)6.6

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_charged_bolts
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 156.2s
  • trigger_min/max:0.0s / 102.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 144.0s
  • uptime_min/max:18.68% / 88.24%

Stack Uptimes

  • charged_bolts_1:48.12%

Spelldata

  • id:1236110
  • name:Charged Bolts
  • tooltip:Damaging nearby targets for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $t sec.
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate18.50.018.516.7s16.6s4.3s26.32%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.5s / 32.0s
  • trigger_min/max:15.5s / 32.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.3s
  • uptime_min/max:18.44% / 34.89%

Stack Uptimes

  • dreamstate_1:16.95%
  • dreamstate_2:9.37%

Spelldata

  • id:450346
  • name:Dreamstate
  • tooltip:Wrath and Starfire cast time reduced by {$s1=40}%.
  • description:{$@spelldesc450347=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$450346u=2} Starfires or Wraths by {$450346s1=40}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar)18.31.219.516.7s16.5s15.1s92.21%95.36%1.2 (1.2)17.5

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 29.5s
  • trigger_min/max:0.1s / 20.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.4s
  • uptime_min/max:89.31% / 94.58%

Stack Uptimes

  • eclipse_lunar_1:92.21%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Starfire damage increased by {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar)4.50.04.574.0s74.0s15.8s23.56%31.10%0.0 (0.0)4.3

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.0s / 118.3s
  • trigger_min/max:16.0s / 118.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:20.96% / 26.67%

Stack Uptimes

  • eclipse_solar_1:23.56%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Crit)2.10.62.8111.8s75.8s35.5s25.24%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 345.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 197.7s
  • uptime_min/max:0.00% / 82.42%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.24%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.62.7112.5s77.5s35.3s24.91%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 358.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 88.85%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.91%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.62.8111.8s77.0s35.3s25.02%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 348.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 78.35%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.02%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.62.7112.4s76.9s35.3s24.83%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 346.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 264.4s
  • uptime_min/max:0.00% / 89.86%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.83%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune20.06.126.115.2s11.6s6.8s45.37%0.00%255.7 (255.7)19.6

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:3.0s / 35.5s
  • trigger_min/max:0.0s / 33.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.5s
  • uptime_min/max:36.12% / 55.12%

Stack Uptimes

  • fury_of_elune_1:45.37%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:{$?a137010=false}[Generating {$=}{{$m4=30}/{$t4=0.500}*{$d=8 seconds}} Rage over {$d=8 seconds}.][Generating {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.]
  • description:{$?a137010=false}[{$@spelldesc428655=Moonfire damage has a chance to call down a Fury of Elune to follow your target for {$=}{{$s2=3000}/1000} sec. {$@=}spellicon202770 {$@=}spellname202770 Calls down a beam of pure celestial energy, dealing {$=}<dmg> Astral damage over {$=}{{$s2=3000}/1000} sec within its area. |cFFFFFFFFGenerates {$?a137010=false}[{$=}{{$202770m4=30}/{$202770t4=0.500}*{$s2=3000}/10000} Rage][{$=}{{$202770m3=25}/{$202770t3=0.500}*{$s2=3000}/10000} Astral Power] over its duration.|r}][Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=25}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r]
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Gathering Moonlight14.927.242.120.2s7.0s13.9s69.25%0.00%0.1 (0.1)0.1

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_gathering_moonlight
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 94.5s
  • trigger_min/max:0.0s / 94.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.9s
  • uptime_min/max:39.63% / 90.48%

Stack Uptimes

  • gathering_moonlight_1:29.95%
  • gathering_moonlight_2:20.98%
  • gathering_moonlight_3:11.62%
  • gathering_moonlight_4:4.82%
  • gathering_moonlight_5:1.48%
  • gathering_moonlight_6:0.39%

Spelldata

  • id:1236989
  • name:Gathering Moonlight
  • tooltip:Casting {$?=}c1[Fury of Elune or Full Moon][Lunar Beam] consumes Gathering Moonlight to increase your damage by {$1236990s1=4}% for {$1236990d=12 seconds}.
  • description:{$@spelldesc1236333=On impact, Starsurges launched by {$?=}c1[Starfire][Thrash] split to up to {$s1=3} additional targets at {$?=}c1[{$s2=40}][{$s3=20}]% effectiveness and grant a stack of Gathering Moonlight. Casting {$?=}c1[Fury of Elune or Full Moon][Lunar Beam] consumes Gathering Moonlight to increase your damage by {$1236990s1=4}% per stack for {$1236990d=12 seconds}.}
  • max_stacks:6
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
I Did That!3.119.622.691.8s13.5s89.1s91.31%0.00%19.6 (19.6)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_i_did_that
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:0.00
  • stat:haste_rating
  • amount:0.00
  • stat:mastery_rating
  • amount:1727.02
  • stat:versatility_rating
  • amount:0.00

Trigger Details

  • interval_min/max:24.0s / 356.7s
  • trigger_min/max:12.0s / 28.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.7s
  • uptime_min/max:69.66% / 100.00%

Stack Uptimes

  • i_did_that_1:91.31%

Spelldata

  • id:1214823
  • name:I Did That!
  • tooltip:Claiming credit from allies! {$?=}e0[Critical Strike increased by {$=}w1. ][]{$?=}e1[Haste increased by {$=}w2. ][]{$?=}e2[Mastery increased by {$=}w3. ][]{$?=}e3[Versatility increased by {$=}w4.][]
  • description:{$@spelldesc1214161=Take Credit for your allies' deeds up to once every {$1215043d=12 seconds}, gaining {$s1=94} of their highest secondary stat up to {$s2=10} times until shortly after leaving combat. You have a {$s3=10}% chance to get caught in the act, transferring all accumulated Credit to your ally for {$1214826d=15 seconds} instead.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune4.50.04.574.0s74.0s15.8s23.56%0.00%0.0 (0.0)4.3

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:20.00
  • duration modifier:0.80
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:10.00%

Trigger Details

  • interval_min/max:16.0s / 118.3s
  • trigger_min/max:16.0s / 118.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:20.96% / 26.67%

Stack Uptimes

  • incarnation_chosen_of_elune_1:23.56%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. {$?a429536=false}[Arcane damage increased by {$=}w6%, haste][Haste] increased by {$=}w1% and critical strike chance by {$=}w2%.
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, {$?a429536=false}[{$s6=10}% increased Arcane damage, ][]and {$s2=10}% critical strike chance. Lasts {$d=20 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:20.00
  • cooldown:1.00
  • default_chance:101.00%
Lunar Amplification37.617.655.38.0s5.3s1.1s14.16%0.00%0.3 (0.3)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_lunar_amplification
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 21.4s
  • trigger_min/max:0.0s / 21.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s
  • uptime_min/max:9.37% / 19.93%

Stack Uptimes

  • lunar_amplification_1:12.19%
  • lunar_amplification_2:1.36%
  • lunar_amplification_3:0.61%

Spelldata

  • id:431250
  • name:Lunar Amplification
  • tooltip:The damage of your next Arcane ability is increased by {$=}w1%.
  • description:{$@spelldesc429529=Each non-Arcane damaging ability you use increases the damage of your next Arcane damaging ability by {$431250s1=3}%, stacking up to {$431250=}U times.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:429529
  • name:Lunar Amplification
  • tooltip:
  • description:Each non-Arcane damaging ability you use increases the damage of your next Arcane damaging ability by {$431250s1=3}%, stacking up to {$431250=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Haste)1.00.01.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_lycaras_teachings_haste
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:6.00%

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:378989
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=3}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mite-y Feast4.34.99.246.9s29.7s45.1s65.18%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_mitey_feast
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:7630.05

Trigger Details

  • interval_min/max:5.0s / 261.9s
  • trigger_min/max:5.0s / 114.5s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 241.8s
  • uptime_min/max:31.75% / 96.10%

Stack Uptimes

  • mitey_feast_1:45.67%
  • mitey_feast_2:16.94%
  • mitey_feast_3:2.45%
  • mitey_feast_4:0.13%
  • mitey_feast_5:0.00%

Spelldata

  • id:1243843
  • name:Mite-y Feast
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc1243818=Your damaging spells have a chance to attract mites to feast on your target, inflicting up to {$=}{{$s1=17776}*{$1243828d=5 seconds}/{$1243828t1=1}} Shadow damage over {$1243828d=5 seconds}. Well-fed mites share their meal with you, each increasing your Intellect by {$s2=2210} for {$1243843d=30 seconds}.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Moonlight Suffusion14.20.014.220.5s20.5s11.8s55.64%62.89%0.0 (0.0)13.6

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_moonlight_suffusion
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 82.3s
  • trigger_min/max:1.0s / 82.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.7s
  • uptime_min/max:38.50% / 60.21%

Stack Uptimes

  • moonlight_suffusion_1:8.36%
  • moonlight_suffusion_2:15.12%
  • moonlight_suffusion_3:15.41%
  • moonlight_suffusion_4:10.31%
  • moonlight_suffusion_5:4.60%
  • moonlight_suffusion_6:1.84%

Spelldata

  • id:1236990
  • name:Moonlight Suffusion
  • tooltip:Damage of your spells and abilities increased by {$?=}c1[{$=}w1][{$=}w2]%.
  • description:{$@spelldesc1236333=On impact, Starsurges launched by {$?=}c1[Starfire][Thrash] split to up to {$s1=3} additional targets at {$?=}c1[{$s2=40}][{$s3=20}]% effectiveness and grant a stack of Gathering Moonlight. Casting {$?=}c1[Fury of Elune or Full Moon][Lunar Beam] consumes Gathering Moonlight to increase your damage by {$1236990s1=4}% per stack for {$1236990d=12 seconds}.}
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Parting Skies12.20.012.225.4s13.1s15.0s54.50%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_parting_skies
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 38.9s
  • trigger_min/max:0.0s / 20.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.9s
  • uptime_min/max:45.02% / 64.61%

Stack Uptimes

  • parting_skies_1:54.50%

Spelldata

  • id:395110
  • name:Parting Skies
  • tooltip:The next Eclipse you enter will trigger Sundered Firmament. {$@=}spellicon394094{$@=}spellname394094 {$@spelldesc394094=Every other Eclipse creates a Fury of Elune at {$s1=25}% effectiveness that follows your current target for {$s2=8} sec.}
  • description:{$@spelldesc394094=Every other Eclipse creates a Fury of Elune at {$s1=25}% effectiveness that follows your current target for {$s2=8} sec.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Solstice18.45.624.016.7s12.7s6.1s37.48%37.24%5.6 (5.6)18.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 24.1s
  • trigger_min/max:0.0s / 20.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:35.84% / 39.66%

Stack Uptimes

  • solstice_1:37.48%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord18.7113.2132.016.3s2.3s14.6s91.32%0.00%76.2 (76.2)17.8

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:4.00%

Trigger Details

  • interval_min/max:15.0s / 24.8s
  • trigger_min/max:0.0s / 12.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:86.74% / 96.08%

Stack Uptimes

  • starlord_1:11.91%
  • starlord_2:13.28%
  • starlord_3:66.13%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:202345
  • name:Starlord
  • tooltip:
  • description:Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Sundered Firmament11.60.111.826.4s26.2s8.0s30.97%0.00%174.2 (174.2)11.3

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_sundered_firmament
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:0.1s / 37.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:28.82% / 33.32%

Stack Uptimes

  • sundered_firmament_1:30.97%

Spelldata

  • id:394108
  • name:Sundered Firmament
  • tooltip:Generating {$=}{({$=}o1/10)*({$394094s1=25}/100)} Astral Power over {$d=8 seconds}.
  • description:{$@spelldesc394094=Every other Eclipse creates a Fury of Elune at {$s1=25}% effectiveness that follows your current target for {$s2=8} sec.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Tempered Potion1.50.01.5300.5s300.5s27.4s13.24%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 304.8s
  • trigger_min/max:300.0s / 304.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • tempered_potion_1:13.24%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Umbral Embrace25.41.927.411.6s10.8s3.2s26.61%0.00%1.9 (1.9)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 135.8s
  • trigger_min/max:0.0s / 135.8s
  • trigger_pct:20.00%
  • duration_min/max:0.0s / 14.5s
  • uptime_min/max:9.69% / 47.68%

Stack Uptimes

  • umbral_embrace_1:26.61%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Wrath and Starfire have a 20% chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=75}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:393760
  • name:Umbral Embrace
  • tooltip:
  • description:Wrath and Starfire have a 20% chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=75}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Inspiration16.98.325.117.7s11.7s7.5s42.43%43.02%8.3 (8.3)16.5

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_umbral_inspiration
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 141.2s
  • trigger_min/max:0.0s / 141.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s
  • uptime_min/max:15.30% / 66.07%

Stack Uptimes

  • umbral_inspiration_1:42.43%

Spelldata

  • id:450419
  • name:Umbral Inspiration
  • tooltip:Moonfire, Sunfire, Stellar Flare, Shooting Stars, and Starfall damage increased by {$=}w1%
  • description:{$@spelldesc450418=Consuming Umbral Embrace increases the damage of your Moonfire, Sunfire, Stellar Flare, Shooting Stars, and Starfall by {$450419s1=30}% for {$450419d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune6.20.06.252.6s52.6s6.0s12.29%12.33%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 77.7s
  • trigger_min/max:45.0s / 77.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s
  • uptime_min/max:8.31% / 17.62%

Stack Uptimes

  • warrior_of_elune_1:4.15%
  • warrior_of_elune_2:4.27%
  • warrior_of_elune_3:3.87%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=30}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=30}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:6.00%

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=3}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]{$?=}{$=}w12<0[ Arcane damage taken reduced by {$=}w13% and all other magic damage taken reduced by {$=}w12%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Midnight Masquerade

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Starfire (False Astral)0.90.05.090.2s16.0s316.3s
Wrath (False Astral)4.80.020.030.1s0.5s312.7s
Uptime Avg % Min Max Avg Dur Min Max
No Eclipse7.77%5.42%10.69%1.3s0.0s5.0s
Eclipse (Lunar)68.65%63.30%72.51%13.7s0.0s15.0s
Both Eclipses23.56%20.96%26.67%15.8s0.0s16.0s
Blooming Infusion Heal Counter91.71%67.24%99.71%46.9s0.0s336.7s
Astral Smolder69.79%43.42%90.41%11.9s0.0s108.0s
Fungal Growth28.36%10.02%55.27%11.7s0.0s56.0s
Astral Power Cap0.20%0.00%1.95%0.5s0.0s3.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune0.8400.00013.09413.2265.82633.509
Warrior of Elune7.0460.00032.70343.49424.95557.791

Player Effects

TypeSpellID#ValueSourceNotes
Attribute MultiplierUrsoc's Spirit44918214.0%Spell DataPassive, Stamina
Bear Form Passive1178229.0%Spell DataManual-entry, Stamina
Lycara's Teachings37899024.0%Spell DataStamina
Matching ArmorLeather Specialization8610425.0%Spell DataPassive, Intellect
Pet MultiplierBalance Druid137013334.0%Spell DataPassive, Pet
Balance Druid137013834.0%Spell DataPassive, Guardian
ExpertiseBear Form548763.0%Spell Data
Crit AvoidanceBear Form54873-6.0%Spell Data
Base Armor MultiplierBear Form54874220.0%Spell Data
Ursine Vigor393903215.0%Spell Data

Modified Spell Data

SpellID#EffectModified ByID#+/%ValueNotes
Wrath190984 2Energize Power Astral Power1979112ADD60Passive
Wild Surges4068902ADD20Passive
Eclipse (Solar)485175PCT60%w/ Buff
Starfire194153 2Energize Power Wild Surges4068902ADD20Passive
Moon Guardian4295201ADD20Passive
Warrior of Elune2024252PCT30%No-stacks, w/ Buff
3Dummy Eclipse (Lunar)485182ADD60w/ Buff
Moonfire8921 3Energize Power Astral Power1979113ADD60Passive
Moon Guardian4295202ADD20Passive
Sunfire93402 3Energize Power Astral Power1979113ADD60Passive

Eclipse Tracker

NoneSolarLunarBoth
AbilityDirectTickDirectTickDirectTickDirectTick
Fungal Growth-7.99%---70.69%-21.32%
Fury of Elune7.30%---61.46%-31.24%-
Moonfire1.21%7.25%--76.91%64.94%21.88%27.81%
Shooting Stars4.18%---67.42%-28.40%-
Starfall--------
Starfire4.13%---62.46%-33.41%-
Starsurge2.63%---66.61%-30.76%-
Sundered Firmament----55.79%-44.21%-
Sunfire3.86%7.24%--72.63%65.05%23.52%27.71%
Sunseeker Mushroom7.57%---69.15%-23.28%-
The Light of Elune6.72%---60.90%-32.38%-
Wrath0.76%---98.76%-0.47%-

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Nêphôr
Fury of EluneAstral Power268.96671.2220.61%2.501.170.17%
Boundless MoonlightAstral Power15.3491.622.81%5.970.400.44%
MoonfireAstral Power14.34114.153.51%7.960.590.52%
Shooting Stars (Moonfire)Astral Power89.28178.105.47%1.990.470.26%
Shooting Stars (Sunfire)Astral Power89.66178.855.49%1.990.470.26%
StarfireAstral Power106.571,344.6941.30%12.620.030.00%
Sundered FirmamentAstral Power185.38111.083.41%0.600.150.14%
Boundless MoonlightAstral Power11.4868.882.12%6.000.000.01%
SunfireAstral Power17.38103.533.18%5.960.740.71%
Sunseeker MushroomAstral Power9.6596.142.95%9.970.330.34%
Boundless MoonlightAstral Power10.2761.241.88%5.970.350.57%
WrathAstral Power30.26236.817.27%7.835.292.19%
Usage Type Count Total Tot% Avg RPE APR
Nêphôr
StarsurgeAstral Power89.683,228.51100.00%36.0036.0083,784.33
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Astral Power16.010.8510.7610.027.80.0100.0

Statistics & Data Analysis

Fight Length
Nêphôr Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Nêphôr Damage Per Second
Count 9999
Mean 3790192.48
Minimum 3317487.52
Maximum 4376395.58
Spread ( max - min ) 1058908.06
Range [ ( max - min ) / 2 * 100% ] 13.97%
Standard Deviation 145197.8153
5th Percentile 3557111.52
95th Percentile 4035978.27
( 95th Percentile - 5th Percentile ) 478866.75
Mean Distribution
Standard Deviation 1452.0508
95.00% Confidence Interval ( 3787346.52 - 3793038.45 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5638
0.1 Scale Factor Error with Delta=300 179971540
0.05 Scale Factor Error with Delta=300 719886159
0.01 Scale Factor Error with Delta=300 17997153967
Priority Target DPS
Nêphôr Priority Target Damage Per Second
Count 9999
Mean 3790192.48
Minimum 3317487.52
Maximum 4376395.58
Spread ( max - min ) 1058908.06
Range [ ( max - min ) / 2 * 100% ] 13.97%
Standard Deviation 145197.8153
5th Percentile 3557111.52
95th Percentile 4035978.27
( 95th Percentile - 5th Percentile ) 478866.75
Mean Distribution
Standard Deviation 1452.0508
95.00% Confidence Interval ( 3787346.52 - 3793038.45 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5638
0.1 Scale Factor Error with Delta=300 179971540
0.05 Scale Factor Error with Delta=300 719886159
0.01 Scale Factor Error with Delta=300 17997153967
DPS(e)
Nêphôr Damage Per Second (Effective)
Count 9999
Mean 3790192.48
Minimum 3317487.52
Maximum 4376395.58
Spread ( max - min ) 1058908.06
Range [ ( max - min ) / 2 * 100% ] 13.97%
Damage
Nêphôr Damage
Count 9999
Mean 1136393392.33
Minimum 827809147.85
Maximum 1491624174.48
Spread ( max - min ) 663815026.63
Range [ ( max - min ) / 2 * 100% ] 29.21%
DTPS
Nêphôr Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Nêphôr Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Nêphôr Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Nêphôr Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Nêphôr Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
1 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
2 0.00 variable,name=on_use_trinket,value=0
3 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_use_buff
4 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_use_buff)*2
5 0.00 moonkin_form
6 0.00 wrath
7 0.00 wrath
8 0.00 starfire,if=!talent.stellar_flare
9 0.00 stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+((talent.bounteous_bloom&buff.bounteous_bloom.up)*15)+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*24
0.00 variable,name=ca_effective_cd,value=cooldown.ca_inc.remains<?cooldown.force_of_nature.remains
0.00 variable,name=pre_cd_condition,value=(!talent.whirling_stars|!talent.convoke_the_spirits|cooldown.convoke_the_spirits.remains<gcd.max*2|fight_remains<cooldown.convoke_the_spirits.remains+3|cooldown.convoke_the_spirits.remains>cooldown.ca_inc.full_recharge_time+15*talent.control_of_the_dream)&(variable.on_use_trinket=0|(variable.on_use_trinket=1|variable.on_use_trinket=3)&(trinket.1.cooldown.remains>cooldown.ca_inc.full_recharge_time+(15*talent.control_of_the_dream)|!talent.convoke_the_spirits&hero_tree.elunes_chosen&(trinket.1.cooldown.duration<=100&trinket.1.cooldown.remains>cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration|trinket.1.cooldown.duration>=100&cooldown.ca_inc.charges_fractional=1&(trinket.1.cooldown.duration>?cooldown.ca_inc.full_recharge_time))|talent.convoke_the_spirits&(cooldown.convoke_the_spirits.remains<3&(ceil((fight_remains-10)%cooldown.convoke_the_spirits.duration)>ceil((fight_remains-trinket.1.cooldown.remains-10)%cooldown.convoke_the_spirits.duration))|cooldown.convoke_the_spirits.remains>trinket.1.cooldown.remains&cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration<trinket.1.cooldown.remains+15)|trinket.1.cooldown.remains+6>fight_remains|trinket.1.cooldown.ready)|variable.on_use_trinket=2&(trinket.2.cooldown.remains>cooldown.ca_inc.full_recharge_time+(15*talent.control_of_the_dream)|!talent.convoke_the_spirits&hero_tree.elunes_chosen&(trinket.2.cooldown.duration<=100&trinket.2.cooldown.remains>cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration|trinket.2.cooldown.duration>=100&cooldown.ca_inc.charges_fractional=1&(trinket.2.cooldown.duration>?cooldown.ca_inc.full_recharge_time))|talent.convoke_the_spirits&(cooldown.convoke_the_spirits.remains<3&(ceil((fight_remains-10)%cooldown.convoke_the_spirits.duration)>ceil((fight_remains-trinket.2.cooldown.remains-10)%cooldown.convoke_the_spirits.duration))|cooldown.convoke_the_spirits.remains>trinket.2.cooldown.remains&cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration<trinket.2.cooldown.remains+15)|trinket.2.cooldown.remains+6>fight_remains|trinket.2.cooldown.ready))&cooldown.ca_inc.remains<gcd.max&!buff.ca_inc.up
0.00 variable,name=cd_condition,value=variable.pre_cd_condition&(fight_remains<(15+5*talent.incarnation_chosen_of_elune)*(1-talent.whirling_stars*0.2)|target.time_to_die>10&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up))
0.00 variable,name=convoke_condition,value=fight_remains<4+gcd.max|(buff.ca_inc.up|cooldown.ca_inc.remains>40)&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up|cooldown.force_of_nature.remains>15)
0.00 variable,name=eclipse_remains,value=buff.eclipse_lunar.remains<?buff.eclipse_solar.remains
0.00 variable,name=enter_lunar,value=talent.lunar_calling|spell_targets.starfire>3-(talent.umbral_intensity|talent.soul_of_the_forest)
0.00 variable,name=boat_stacks,value=buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack
0.00 variable,name=tww3_keeper_4pc,value=hero_tree.keeper_of_the_grove&set_bonus.tww3_4pc
0.00 variable,name=kotg_single_ca_condition,value=variable.tww3_keeper_4pc&!buff.ca_inc.up&cooldown.ca_inc.ready&((variable.on_use_trinket=1&(trinket.1.cooldown.ready|fight_remains<trinket.1.cooldown.remains)|variable.on_use_trinket=2&(trinket.2.cooldown.ready|fight_remains<trinket.2.cooldown.remains)|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.2.cooldown.ready|fight_remains<(trinket.1.cooldown.remains>?trinket.2.cooldown.remains)))&(cooldown.convoke_the_spirits.remains<gcd.max*3-0.5|fight_remains<cooldown.convoke_the_spirits.remains|!talent.convoke_the_spirits)&(cooldown.force_of_nature.remains<gcd.max*2-0.3&!(fight_remains>cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration*0.3+gcd.max&fight_remains<cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+gcd.max*2))&(cooldown.ca_inc.full_recharge_time>20&fight_remains>(cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+2|fight_remains<cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration+gcd.max&!(fight_remains>cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration*0.3+gcd.max&cooldown.ca_inc.full_recharge_time>cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+gcd.max&fight_remains>cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+buff.harmony_of_the_grove.duration+gcd.max)&!(!cooldown.potion.ready&fight_remains>cooldown.potion.remains+buff.harmony_of_the_grove.duration)|!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration*2+buff.dryad.duration+2&fight_remains>(cooldown.potion.remains+4+buff.dryad.duration+2+gcd.max<?cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max<?(cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.duration+(variable.on_use_trinket=2)*trinket.2.cooldown.duration+(variable.on_use_trinket=3)*(trinket.1.cooldown.duration>?trinket.2.cooldown.duration)+4+buff.dryad.duration+2+gcd.max))|fight_remains<buff.ca_inc.duration+gcd.max*(1+(dot.moonfire.remains<(3>?fight_remains)+dot.sunfire.remains<(buff.ca_inc.duration+gcd.max>?fight_remains)<?dot.sunfire.remains<(buff.ca_inc.duration>?fight_remains)+dot.moonfire.remains<(3+gcd.max>?fight_remains))))
0.00 variable,name=kotg_double_ca_condition,value=variable.tww3_keeper_4pc&!buff.ca_inc.up&(variable.on_use_trinket=1&(trinket.1.cooldown.ready|trinket.1.proc.any_dps.up)|variable.on_use_trinket=2&(trinket.2.cooldown.ready|trinket.2.proc.any_dps.up)|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.1.proc.any_dps.up|trinket.2.cooldown.ready|trinket.2.proc.any_dps.up))&(cooldown.convoke_the_spirits.remains<gcd.max*2-0.3|!talent.convoke_the_spirits)&(cooldown.ca_inc.full_recharge_time<4+gcd.max*3&(cooldown.force_of_nature.ready|buff.harmony_of_the_grove.up|cooldown.force_of_nature.remains<gcd.max*3-0.5&fight_remains<cooldown.force_of_nature.remains+buff.dryad.duration+2+4+gcd.max*4)|(cooldown.ca_inc.full_recharge_time-gcd.max<?cooldown.force_of_nature.remains)<buff.dryad.duration&(fight_remains<cooldown.force_of_nature.remains+buff.dryad.duration+2+4+gcd.max*2|fight_remains<cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration+gcd.max&fight_remains<cooldown.ca_inc.full_recharge_time-buff.dryad.duration-gcd.max))&!(!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration*2+buff.dryad.duration+2+gcd.max&fight_remains>(cooldown.potion.remains+buff.dryad.duration+2+gcd.max<?buff.dryad.duration+2+4+gcd.max*6)&(fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max|fight_remains>((cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.duration+(variable.on_use_trinket=2)*trinket.2.cooldown.duration+(variable.on_use_trinket=3)*(trinket.1.cooldown.duration>?trinket.2.cooldown.duration)+4+buff.dryad.duration+2+gcd.max)))
0.00 variable,name=kotg_second_ca_condition,value=variable.tww3_keeper_4pc&buff.ca_inc.up&((buff.harmony_of_the_grove.up&(cooldown.convoke_the_spirits.remains>30|buff.harmony_of_the_grove.remains<gcd.max*2|buff.dryads_favor.up)&!(!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max&fight_remains>(cooldown.potion.remains+buff.dryad.duration+2+gcd.max<?cooldown.ca_inc.full_recharge_time+buff.dryad.duration+2+gcd.max)&(fight_remains<cooldown.ca_inc.full_recharge_time+buff.dryad.duration+2+gcd.max|fight_remains>((cooldown.convoke_the_spirits.remains-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.remains+(variable.on_use_trinket=2)*trinket.2.cooldown.remains+(variable.on_use_trinket=3)*(trinket.1.cooldown.remains>?trinket.2.cooldown.remains)+4+buff.dryad.duration+2+gcd.max))))|fight_remains<buff.dryad.duration+2+gcd.max)
0.00 variable,name=kotg_inc_condition,value=variable.tww3_keeper_4pc&astral_power.deficit<=50&(variable.on_use_trinket=1&trinket.1.cooldown.ready|variable.on_use_trinket=2&trinket.2.cooldown.ready|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.2.cooldown.ready)|(trinket.1.cooldown.remains>cooldown.force_of_nature.duration|trinket.2.cooldown.remains>cooldown.force_of_nature.duration)&cooldown.force_of_nature.remains<gcd.max*2)|fight_remains<(cooldown.ca_inc.full_recharge_time>?cooldown.force_of_nature.remains)
0.00 variable,name=pool_for_cd,value=astral_power<(variable.kotg_single_ca_condition*action.starsurge.cost*2<?variable.kotg_double_ca_condition*(action.starsurge.cost*2-action.force_of_nature.energize_amount)<?(!buff.ca_inc.up&fight_remains>cooldown.ca_inc.remains+2+gcd.max&fight_remains<(fight_remains-cooldown.ca_inc.remains>?buff.ca_inc.duration)+5)*action.starsurge.cost*3<?(!buff.ca_inc.up&fight_remains>cooldown.ca_inc.full_recharge_time+2+gcd.max&fight_remains<(fight_remains-cooldown.ca_inc.full_recharge_time>?buff.ca_inc.duration)+4+8)*(action.starsurge.cost*3-action.force_of_nature.energize_amount*(cooldown.force_of_nature.ready)))
0.00 variable,name=pool_in_ca,value=buff.dryad.up&fight_remains>buff.dryad.remains&cooldown.convoke_the_spirits.remains>buff.dryad.remains&(astral_power-action.starsurge.cost+(0<?floor((buff.dryad.remains+2-gcd.max*2-0.5)%action.wrath.execute_time))*action.wrath.energize_amount)<action.starsurge.cost*2
0.00 use_item,name=imperfect_ascendancy_serum,if=dot.sunfire.remains>4&(dot.moonfire.remains>4|talent.treants_of_the_moon&(cooldown.force_of_nature.remains<3|buff.harmony_of_the_grove.up)&variable.ca_effective_cd<1|fight_remains<20|fight_remains<variable.ca_effective_cd&(buff.harmony_of_the_grove.up|cooldown.convoke_the_spirits.ready))&buff.spymasters_report.stack<=29
0.00 variable,name=generic_trinket_condition,value=(buff.dryad.up|buff.ca_inc.up)|variable.no_cd_talent|fight_remains<variable.ca_effective_cd&(buff.harmony_of_the_grove.up|cooldown.convoke_the_spirits.ready)&!cooldown.ca_inc.ready|(buff.spymasters_report.stack+variable.ca_effective_cd%6)>29&variable.ca_effective_cd>20|variable.on_use_trinket=0
0.00 use_item,slot=trinket1,if=!trinket.1.is.spymasters_web&!trinket.1.is.imperfect_ascendancy_serum&!trinket.1.is.treacherous_transmitter&!trinket.1.is.soulletting_ruby&(variable.on_use_trinket!=1&variable.on_use_trinket!=3&trinket.2.cooldown.remains>20|fight_remains<(20+20*(trinket.2.has_use&trinket.2.cooldown.remains<25))|variable.generic_trinket_condition)
0.00 use_item,slot=trinket2,if=!trinket.2.is.spymasters_web&!trinket.2.is.imperfect_ascendancy_serum&!trinket.2.is.treacherous_transmitter&!trinket.2.is.soulletting_ruby&(variable.on_use_trinket<2&trinket.1.cooldown.remains>20|variable.on_use_trinket=3&trinket.1.cooldown.remains>20&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up|ceil((fight_remains-15)%trinket.2.cooldown.duration)>ceil((fight_remains-cooldown.force_of_nature.remains-15)%trinket.2.cooldown.duration))|fight_remains<(20+20*(trinket.1.has_use&trinket.1.cooldown.remains<25))|variable.generic_trinket_condition)
0.00 use_items
A 0.25 potion,if=fight_remains<=30
0.00 invoke_external_buff,name=power_infusion,if=variable.cd_condition&!variable.tww3_keeper_4pc|variable.tww3_keeper_4pc&(variable.kotg_single_ca_condition|variable.kotg_double_ca_condition)
0.00 berserking,if=variable.no_cd_talent|fight_remains<15
B 0.00 run_action_list,name=kotg_st,if=variable.tww3_keeper_4pc&spell_targets=1
C 0.00 run_action_list,name=st,if=!variable.tww3_keeper_4pc&spell_targets=1
D 0.00 run_action_list,name=aoe,if=spell_targets>1
actions.pre_cd
# count action,conditions
0.00 use_item,name=spymasters_web,if=variable.cd_condition&(buff.spymasters_report.stack>29|fight_remains<cooldown.ca_inc.duration)
0.00 do_treacherous_transmitter_task,if=variable.cd_condition|buff.harmony_of_the_grove.up&(buff.spymasters_report.stack>29|!trinket.1.is.spymasters_web|!trinket.2.is.spymasters_web)
0.00 berserking,if=variable.cd_condition
G 1.22 potion,if=variable.cd_condition
0.00 use_item,slot=trinket1,if=!trinket.1.is.spymasters_web&!trinket.1.is.imperfect_ascendancy_serum&!trinket.1.is.treacherous_transmitter&!trinket.1.is.soulletting_ruby&(variable.on_use_trinket=1|variable.on_use_trinket=3)&variable.cd_condition
0.00 use_item,slot=trinket2,if=!trinket.2.is.spymasters_web&!trinket.2.is.imperfect_ascendancy_serum&!trinket.2.is.treacherous_transmitter&!trinket.2.is.soulletting_ruby&variable.on_use_trinket=2&variable.cd_condition
0.00 use_item,name=bestinslots,if=hero_tree.keeper_of_the_grove&buff.harmony_of_the_grove.up|hero_tree.elunes_chosen&(cooldown.ca_inc.full_recharge_time>20|buff.ca_inc.up)
actions.st
# count action,conditions
H 6.17 warrior_of_elune,if=talent.lunar_calling&!buff.dreamstate.up&(buff.ca_inc.up|cooldown.ca_inc.remains>10|fight_remains<cooldown.ca_inc.remains+5)|!talent.lunar_calling&variable.eclipse_remains<=7
I 3.22 fury_of_elune,if=(cooldown.ca_inc.remains<?variable.eclipse_remains)<gcd.max|cooldown.ca_inc.remains<fight_remains&fight_remains<(buff.ca_inc.duration+gcd.max>?fight_remains-cooldown.ca_inc.remains)+gcd.max|fight_remains<8+gcd.max
J 11.40 wrath,if=variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time&!(cooldown.ca_inc.remains<action.starfire.cast_time)
K 1.54 starfire,if=(!variable.enter_lunar|cooldown.ca_inc.remains<cast_time)&eclipse.in_eclipse&variable.eclipse_remains<cast_time
L 5.93 sunfire,target_if=remains<3|refreshable&(hero_tree.keeper_of_the_grove&cooldown.force_of_nature.ready|hero_tree.elunes_chosen&variable.cd_condition)
M 2.51 moonfire,target_if=remains<3&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)
N 12.52 fury_of_elune,if=5+variable.passive_asp<astral_power.deficit&(!(cooldown.ca_inc.remains<variable.eclipse_remains&variable.eclipse_remains<12)|buff.dreamstate.up&cooldown.ca_inc.remains<gcd.max)
O 0.00 call_action_list,name=pre_cd
0.00 celestial_alignment,if=variable.cd_condition
P 4.47 incarnation,if=variable.cd_condition&(buff.dreamstate.stack=2|prev_gcd.1.fury_of_elune&buff.dreamstate.up|fight_remains<buff.ca_inc.duration+gcd.max)
Q 17.01 wrath,if=variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
0.00 starfire,if=!variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
R 7.38 starsurge,if=variable.cd_condition&astral_power.deficit>variable.passive_asp+action.force_of_nature.energize_amount
0.00 force_of_nature,if=variable.pre_cd_condition|cooldown.ca_inc.full_recharge_time+5+15*talent.control_of_the_dream>cooldown&(!talent.convoke_the_spirits|cooldown.convoke_the_spirits.remains+10+15*talent.control_of_the_dream>cooldown|fight_remains<cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration+5)&(variable.on_use_trinket=0|cooldown.ca_inc.remains>20|talent.convoke_the_spirits&cooldown.convoke_the_spirits.remains>20|(variable.on_use_trinket=1|variable.on_use_trinket=3)&(trinket.1.cooldown.remains>5+15*talent.control_of_the_dream|trinket.1.cooldown.ready)|variable.on_use_trinket=2&(trinket.2.cooldown.remains>5+15*talent.control_of_the_dream|trinket.2.cooldown.ready))&(fight_remains>cooldown+5|fight_remains<cooldown.ca_inc.remains+7)|talent.whirling_stars&talent.convoke_the_spirits&cooldown.convoke_the_spirits.remains>cooldown.force_of_nature.duration-10&fight_remains>cooldown.convoke_the_spirits.remains+6
0.00 starfall,if=buff.starweavers_warp.up
S 42.98 starsurge,if=talent.starlord&buff.starlord.stack<3
T 11.45 sunfire,target_if=refreshable
U 11.83 moonfire,target_if=refreshable&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)
V 18.39 starsurge,if=cooldown.convoke_the_spirits.remains<gcd.max*2&variable.convoke_condition&astral_power.deficit<50
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-target>7+spell_targets)
W 14.56 starsurge,if=buff.starlord.remains>4&variable.boat_stacks>=3|fight_remains<4
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount|fight_remains<20|cooldown.ca_inc.remains>15
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)|fight_remains<20|cooldown.ca_inc.remains>15
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)|fight_remains<20|cooldown.ca_inc.remains>15
0.00 starsurge,if=buff.starweavers_weft.up|buff.touch_the_cosmos.up
X 6.37 starsurge,if=astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max+action.starfire.cast_time))
0.00 force_of_nature,if=!hero_tree.keeper_of_the_grove
0.00 wild_mushroom,if=!prev_gcd.1.wild_mushroom&dot.fungal_growth.remains<2
Y 104.38 starfire,if=talent.lunar_calling
0.00 wrath

Sample Sequence

12345678LMNGPSYHSYWYYVYVYWYTYYUVIPSYYSYSYWYYVYYTVYNJQSSSYUVYVYYVYTHJQSNYSYWYYUVYYJQSLSYNWYYXYYJQSSMLSYYYNYXYQQSSRLURYYRYYKIPSYSYHVTWYWYYUVYVYJNQSYSYTVYVYYSJQUSYNVYTVYVYSHJQYWYYUWNYTYXSYQQSSYYWYYTNSMYQQSRYRYYRYLYYIPSUWYWYHYVYVYYSTYJNQSWUYVYYVSYTSJQYYNVYVYSUSYTJQSYHYWYNYXSYYSUJQTWYYYXSIYYSYQQ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre1no_cd_talent
[precombat]
Nêphôr 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre2on_use_trinket
[precombat]
Nêphôr 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre3on_use_trinket
[precombat]
Nêphôr 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre4on_use_trinket
[precombat]
Nêphôr 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre5moonkin_form
[precombat]
Nêphôr 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre6wrath
[precombat]
Fluffy_Pillow 0.0/100 0% AP flask_of_alchemical_chaos_mastery
Pre7wrath
[precombat]
Fluffy_Pillow 8.0/100 8% AP dreamstate(2), umbral_embrace, flask_of_alchemical_chaos_mastery
Pre8starfire
[precombat]
Fluffy_Pillow 16.0/100 16% AP balance_of_all_things_arcane(10), dreamstate(2), eclipse_lunar, parting_skies, umbral_embrace, flask_of_alchemical_chaos_mastery
0:00.000Lsunfire
[st]
Fluffy_Pillow 16.0/100 16% AP bloodlust, balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery
0:00.913Mmoonfire
[st]
Fluffy_Pillow 34.0/100 34% AP bloodlust, balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, umbral_inspiration, lunar_amplification, i_did_that, flask_of_alchemical_chaos_mastery
0:01.826Nfury_of_elune
[st]
Fluffy_Pillow 44.0/100 44% AP bloodlust, balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, parting_skies, solstice, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery
0:02.740Gpotion
[pre_cd]
Fluffy_Pillow 50.5/100 50% AP bloodlust, balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, parting_skies, solstice, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery
0:02.740Pincarnation_chosen_of_elune
[st]
Fluffy_Pillow 50.5/100 50% AP bloodlust, balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, parting_skies, solstice, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:02.740Sstarsurge
[st]
Fluffy_Pillow 50.5/100 50% AP bloodlust, balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:03.543Ystarfire
[st]
Fluffy_Pillow 22.1/100 22% AP bloodlust, balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:04.296Hwarrior_of_elune
[st]
Fluffy_Pillow 41.8/100 42% AP bloodlust, balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord, umbral_embrace, umbral_inspiration, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:04.296Sstarsurge
[st]
Fluffy_Pillow 41.8/100 42% AP bloodlust, balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(2), umbral_embrace, umbral_inspiration, warrior_of_elune(3), i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.051Ystarfire
[st]
Fluffy_Pillow 13.4/100 13% AP bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_embrace, umbral_inspiration, warrior_of_elune(3), gathering_moonlight, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:05.806Wstarsurge
[st]
Fluffy_Pillow 36.7/100 37% AP bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune(2), gathering_moonlight, i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:06.560Ystarfire
[st]
Fluffy_Pillow 8.3/100 8% AP bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune(2), gathering_moonlight(2), i_did_that, flask_of_alchemical_chaos_mastery, tempered_potion
0:07.316Ystarfire
[st]
Fluffy_Pillow 29.6/100 30% AP bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune, gathering_moonlight(2), i_did_that, flask_of_alchemical_chaos_crit, tempered_potion
0:08.070Vstarsurge
[st]
Fluffy_Pillow 52.8/100 53% AP bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight(2), i_did_that, flask_of_alchemical_chaos_crit, tempered_potion
0:08.822Ystarfire
[st]
Fluffy_Pillow 24.5/100 25% AP bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(3), i_did_that, flask_of_alchemical_chaos_crit, tempered_potion
0:09.898Vstarsurge
[st]
Fluffy_Pillow 51.2/100 51% AP bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(3), i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:10.652Ystarfire
[st]
Fluffy_Pillow 15.8/100 16% AP bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(3), i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:11.728Wstarsurge
[st]
Fluffy_Pillow 36.4/100 36% AP bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:12.482Ystarfire
[st]
Fluffy_Pillow 0.4/100 0% AP bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:13.558Tsunfire
[st]
Fluffy_Pillow 14.4/100 14% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:14.313Ystarfire
[st]
Fluffy_Pillow 20.4/100 20% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), lunar_amplification, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:15.391Ystarfire
[st]
Fluffy_Pillow 36.9/100 37% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_embrace, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:16.467Umoonfire
[st]
Fluffy_Pillow 56.4/100 56% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:17.222Vstarsurge
[st]
Fluffy_Pillow 68.9/100 69% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(4), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:17.978Ifury_of_elune
[st]
Fluffy_Pillow 41.4/100 41% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, umbral_inspiration, gathering_moonlight(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:18.783Pincarnation_chosen_of_elune
[st]
Fluffy_Pillow 43.9/100 44% AP bloodlust, dreamstate(2), fury_of_elune, parting_skies, umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:18.783Sstarsurge
[st]
Fluffy_Pillow 43.9/100 44% AP bloodlust, balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:19.586Ystarfire
[st]
Fluffy_Pillow 13.5/100 14% AP bloodlust, balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord, umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:20.340Ystarfire
[st]
Fluffy_Pillow 31.2/100 31% AP bloodlust, balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord, umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:21.093Sstarsurge
[st]
Fluffy_Pillow 50.8/100 51% AP bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord, umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit, tempered_potion
0:21.868Ystarfire
[st]
Fluffy_Pillow 20.5/100 21% AP bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(2), umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna(2), flask_of_alchemical_chaos_crit, tempered_potion
0:22.985Sstarsurge
[st]
Fluffy_Pillow 47.2/100 47% AP bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(2), moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna(2), flask_of_alchemical_chaos_crit, tempered_potion
0:23.739Ystarfire
[st]
Fluffy_Pillow 16.3/100 16% AP bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:24.816Wstarsurge
[st]
Fluffy_Pillow 39.1/100 39% AP bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:25.571Ystarfire
[st]
Fluffy_Pillow 6.2/100 6% AP bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:26.648Ystarfire
[st]
Fluffy_Pillow 30.4/100 30% AP bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:27.725Vstarsurge
[st]
Fluffy_Pillow 58.0/100 58% AP bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:28.479Ystarfire
[st]
Fluffy_Pillow 33.0/100 33% AP bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:29.557Ystarfire
[st]
Fluffy_Pillow 49.0/100 49% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:30.636Tsunfire
[st]
Fluffy_Pillow 65.5/100 66% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit, tempered_potion
0:31.391Vstarsurge
[st]
Fluffy_Pillow 74.0/100 74% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, lunar_amplification, gathering_moonlight(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit, tempered_potion
0:32.145Ystarfire
[st]
Fluffy_Pillow 43.0/100 43% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit, tempered_potion
0:33.221Nfury_of_elune
[st]
Fluffy_Pillow 68.0/100 68% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:33.975Jwrath
[st]
Fluffy_Pillow 76.5/100 77% AP bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, parting_skies, umbral_inspiration, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:34.807Qwrath
[st]
Fluffy_Pillow 91.5/100 92% AP bloodlust, dreamstate(2), fury_of_elune, parting_skies, umbral_inspiration, lunar_amplification, gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:35.560Sstarsurge
[st]
Fluffy_Pillow 100.0/100 100% AP bloodlust, balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, lunar_amplification(2), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:36.473Sstarsurge
[st]
Fluffy_Pillow 74.2/100 74% AP bloodlust, balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord, gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:37.353Sstarsurge
[st]
Fluffy_Pillow 48.4/100 48% AP bloodlust, balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(2), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:38.196Ystarfire
[st]
Fluffy_Pillow 17.5/100 17% AP bloodlust, balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:38.952Umoonfire
[st]
Fluffy_Pillow 37.7/100 38% AP bloodlust, balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:39.766Vstarsurge
[st]
Fluffy_Pillow 53.3/100 53% AP bloodlust, balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
0:40.579Ystarfire
[st]
Fluffy_Pillow 23.0/100 23% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:42.161Vstarsurge
[st]
Fluffy_Pillow 51.8/100 52% AP balance_of_all_things_arcane(4), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:43.217Ystarfire
[st]
Fluffy_Pillow 19.0/100 19% AP balance_of_all_things_arcane(3), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight, moonlight_suffusion(4), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:44.797Ystarfire
[st]
Fluffy_Pillow 37.6/100 38% AP balance_of_all_things_arcane, eclipse_lunar, starlord(3), gathering_moonlight(2), moonlight_suffusion(4), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:46.377Vstarsurge
[st]
Fluffy_Pillow 53.6/100 54% AP eclipse_lunar, starlord(3), gathering_moonlight(2), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:47.432Ystarfire
[st]
Fluffy_Pillow 17.6/100 18% AP eclipse_lunar, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:49.012Tsunfire
[st]
Fluffy_Pillow 29.6/100 30% AP eclipse_lunar, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:50.067Hwarrior_of_elune
[st]
Fluffy_Pillow 35.6/100 36% AP eclipse_lunar, starlord(3), lunar_amplification, gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:50.067Jwrath
[st]
Fluffy_Pillow 35.6/100 36% AP eclipse_lunar, starlord(3), warrior_of_elune(3), lunar_amplification, gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:51.123Qwrath
[st]
Fluffy_Pillow 45.6/100 46% AP dreamstate(2), warrior_of_elune(3), lunar_amplification(2), gathering_moonlight(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:51.876Sstarsurge
[st]
Fluffy_Pillow 53.6/100 54% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, warrior_of_elune(3), lunar_amplification(3), gathering_moonlight(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:53.057Nfury_of_elune
[st]
Fluffy_Pillow 19.6/100 20% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, parting_skies, solstice, starlord, warrior_of_elune(3), gathering_moonlight(3), mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:54.193Ystarfire
[st]
Fluffy_Pillow 24.6/100 25% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord, warrior_of_elune(3), moonlight_suffusion(3), mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:54.947Sstarsurge
[st]
Fluffy_Pillow 46.7/100 47% AP balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord, warrior_of_elune(2), moonlight_suffusion(3), mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:56.083Ystarfire
[st]
Fluffy_Pillow 20.2/100 20% AP balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(2), warrior_of_elune(2), moonlight_suffusion(3), mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
0:57.178Wstarsurge
[st]
Fluffy_Pillow 38.3/100 38% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), warrior_of_elune, moonlight_suffusion(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:58.232Ystarfire
[st]
Fluffy_Pillow 7.3/100 7% AP balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), warrior_of_elune, gathering_moonlight, moonlight_suffusion(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
0:59.287Ystarfire
[st]
Fluffy_Pillow 29.9/100 30% AP balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), astral_antenna, flask_of_alchemical_chaos_crit
1:00.868Umoonfire
[st]
Fluffy_Pillow 52.9/100 53% AP balance_of_all_things_arcane, eclipse_lunar, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), astral_antenna, flask_of_alchemical_chaos_crit
1:01.923Vstarsurge
[st]
Fluffy_Pillow 66.9/100 67% AP eclipse_lunar, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), astral_antenna, flask_of_alchemical_chaos_crit
1:02.976Ystarfire
[st]
Fluffy_Pillow 32.9/100 33% AP eclipse_lunar, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), astral_antenna, flask_of_alchemical_chaos_crit
1:04.556Ystarfire
[st]
Fluffy_Pillow 46.9/100 47% AP eclipse_lunar, parting_skies, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(3), i_did_that, astral_antenna, flask_of_alchemical_chaos_crit
1:06.137Jwrath
[st]
Fluffy_Pillow 58.9/100 59% AP eclipse_lunar, parting_skies, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight, i_did_that, astral_antenna, flask_of_alchemical_chaos_crit
1:07.193Qwrath
[st]
Fluffy_Pillow 66.9/100 67% AP dreamstate(2), parting_skies, umbral_embrace, umbral_inspiration, lunar_amplification, gathering_moonlight, charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:07.945Sstarsurge
[st]
Fluffy_Pillow 74.9/100 75% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, sundered_firmament, solstice, umbral_embrace, umbral_inspiration, lunar_amplification(2), gathering_moonlight(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:09.128Lsunfire
[st]
Fluffy_Pillow 42.1/100 42% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord, umbral_embrace, umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:10.267Sstarsurge
[st]
Fluffy_Pillow 51.3/100 51% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord, umbral_embrace, umbral_inspiration, lunar_amplification, gathering_moonlight(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:11.408Ystarfire
[st]
Fluffy_Pillow 19.1/100 19% AP balance_of_all_things_arcane(7), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord(2), umbral_embrace, umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:12.395Nfury_of_elune
[st]
Fluffy_Pillow 33.7/100 34% AP balance_of_all_things_arcane(6), eclipse_lunar, sundered_firmament, solstice, starlord(2), umbral_embrace, umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:13.492Wstarsurge
[st]
Fluffy_Pillow 50.5/100 51% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_embrace, umbral_inspiration, lunar_amplification, moonlight_suffusion(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:14.550Ystarfire
[st]
Fluffy_Pillow 20.7/100 21% AP balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, sundered_firmament, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:16.135Ystarfire
[st]
Fluffy_Pillow 48.0/100 48% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:17.720Xstarsurge
[st]
Fluffy_Pillow 69.5/100 70% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:18.778Ystarfire
[st]
Fluffy_Pillow 40.5/100 41% AP eclipse_lunar, fury_of_elune, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
1:20.364Ystarfire
[st]
Fluffy_Pillow 62.0/100 62% AP eclipse_lunar, fury_of_elune, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:21.947Jwrath
[st]
Fluffy_Pillow 84.5/100 85% AP eclipse_lunar, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:23.006Qwrath
[st]
Fluffy_Pillow 92.5/100 93% AP dreamstate(2), umbral_embrace, lunar_amplification, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:23.760Sstarsurge
[st]
Fluffy_Pillow 100.0/100 100% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, umbral_embrace, lunar_amplification(2), gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:24.945Sstarsurge
[st]
Fluffy_Pillow 68.0/100 68% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, parting_skies, solstice, starlord, umbral_embrace, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:26.084Mmoonfire
[st]
Fluffy_Pillow 32.0/100 32% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(2), umbral_embrace, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:27.181Lsunfire
[st]
Fluffy_Pillow 42.0/100 42% AP balance_of_all_things_arcane(7), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(2), umbral_embrace, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:28.278Sstarsurge
[st]
Fluffy_Pillow 50.0/100 50% AP balance_of_all_things_arcane(6), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(2), umbral_embrace, lunar_amplification, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:29.375Ystarfire
[st]
Fluffy_Pillow 14.0/100 14% AP balance_of_all_things_arcane(5), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(3), umbral_embrace, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:30.329Ystarfire
[st]
Fluffy_Pillow 26.0/100 26% AP balance_of_all_things_arcane(4), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:31.914Ystarfire
[st]
Fluffy_Pillow 38.0/100 38% AP balance_of_all_things_arcane(2), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight, charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:33.501Nfury_of_elune
[st]
Fluffy_Pillow 50.0/100 50% AP balance_of_all_things_arcane, eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:34.560Ystarfire
[st]
Fluffy_Pillow 57.0/100 57% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:36.147Xstarsurge
[st]
Fluffy_Pillow 78.5/100 78% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), moonlight_suffusion(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
1:37.205Ystarfire
[st]
Fluffy_Pillow 47.5/100 48% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(3), gathering_moonlight(2), moonlight_suffusion(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
1:38.724Qwrath
[st]
Fluffy_Pillow 79.0/100 79% AP dreamstate(2), fury_of_elune, parting_skies, starlord(3), gathering_moonlight(2), moonlight_suffusion(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
1:39.479Qwrath
[st]
Fluffy_Pillow 89.5/100 90% AP dreamstate, fury_of_elune, parting_skies, lunar_amplification, gathering_moonlight(2), moonlight_suffusion(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
1:40.234Sstarsurge
[st]
Fluffy_Pillow 100.0/100 100% AP balance_of_all_things_arcane(10), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, lunar_amplification(2), gathering_moonlight(3), moonlight_suffusion(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
1:41.369Sstarsurge
[st]
Fluffy_Pillow 70.2/100 70% AP balance_of_all_things_arcane(9), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord, gathering_moonlight(3), moonlight_suffusion(2), mitey_feast, flask_of_alchemical_chaos_haste
1:42.459Rstarsurge
[st]
Fluffy_Pillow 45.9/100 46% AP balance_of_all_things_arcane(8), eclipse_lunar, sundered_firmament, solstice, starlord(2), gathering_moonlight(3), moonlight_suffusion(2), mitey_feast, flask_of_alchemical_chaos_haste
1:43.511Lsunfire
[st]
Fluffy_Pillow 13.1/100 13% AP balance_of_all_things_arcane(7), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(3), moonlight_suffusion(2), mitey_feast, flask_of_alchemical_chaos_haste
1:44.524Umoonfire
[st]
Fluffy_Pillow 24.3/100 24% AP balance_of_all_things_arcane(6), eclipse_lunar, sundered_firmament, solstice, starlord(3), lunar_amplification, gathering_moonlight(3), moonlight_suffusion(2), mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
1:45.537Rstarsurge
[st]
Fluffy_Pillow 37.5/100 38% AP balance_of_all_things_arcane(5), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(3), mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
1:46.552Ystarfire
[st]
Fluffy_Pillow 4.7/100 5% AP balance_of_all_things_arcane(4), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight(3), mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
1:48.072Ystarfire
[st]
Fluffy_Pillow 18.5/100 18% AP balance_of_all_things_arcane(3), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
1:49.591Rstarsurge
[st]
Fluffy_Pillow 47.1/100 47% AP balance_of_all_things_arcane, eclipse_lunar, starlord(3), gathering_moonlight(3), mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
1:50.604Ystarfire
[st]
Fluffy_Pillow 13.1/100 13% AP eclipse_lunar, starlord(3), gathering_moonlight(4), astral_antenna, flask_of_alchemical_chaos_haste
1:52.122Ystarfire
[st]
Fluffy_Pillow 25.1/100 25% AP eclipse_lunar, starlord(3), gathering_moonlight(5), astral_antenna, flask_of_alchemical_chaos_haste
1:53.643Kstarfire
[st]
Fluffy_Pillow 37.1/100 37% AP eclipse_lunar, starlord(3), gathering_moonlight(5), i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
1:55.163Ifury_of_elune
[st]
Fluffy_Pillow 53.1/100 53% AP dreamstate(2), starlord(3), umbral_embrace, gathering_moonlight(6), i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
1:56.175Pincarnation_chosen_of_elune
[st]
Fluffy_Pillow 60.1/100 60% AP dreamstate(2), fury_of_elune, umbral_embrace, gathering_moonlight, moonlight_suffusion(6), i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
1:56.175Sstarsurge
[st]
Fluffy_Pillow 60.1/100 60% AP balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, umbral_embrace, gathering_moonlight, moonlight_suffusion(6), i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
1:57.208Ystarfire
[st]
Fluffy_Pillow 34.3/100 34% AP balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord, umbral_embrace, gathering_moonlight, moonlight_suffusion(6), i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
1:58.103Sstarsurge
[st]
Fluffy_Pillow 49.4/100 49% AP balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord, umbral_inspiration, gathering_moonlight, moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
1:59.097Ystarfire
[st]
Fluffy_Pillow 35.6/100 36% AP balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord(2), umbral_inspiration, lunar_amplification, gathering_moonlight, moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
1:59.958Hwarrior_of_elune
[st]
Fluffy_Pillow 55.8/100 56% AP balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord(2), umbral_inspiration, gathering_moonlight, moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
1:59.958Vstarsurge
[st]
Fluffy_Pillow 55.8/100 56% AP balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_inspiration, warrior_of_elune(3), gathering_moonlight, moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:00.879Tsunfire
[st]
Fluffy_Pillow 26.0/100 26% AP balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_inspiration, warrior_of_elune(3), gathering_moonlight(2), moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:01.799Wstarsurge
[st]
Fluffy_Pillow 45.7/100 46% AP balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, solstice, starlord(3), umbral_inspiration, warrior_of_elune(3), lunar_amplification, gathering_moonlight(2), moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:02.721Ystarfire
[st]
Fluffy_Pillow 10.9/100 11% AP balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, starlord(3), umbral_inspiration, warrior_of_elune(3), gathering_moonlight(2), moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:03.642Wstarsurge
[st]
Fluffy_Pillow 43.1/100 43% AP balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, starlord(3), umbral_inspiration, warrior_of_elune(2), lunar_amplification, gathering_moonlight(2), moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:04.562Ystarfire
[st]
Fluffy_Pillow 14.3/100 14% AP balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, starlord(3), warrior_of_elune(2), gathering_moonlight(3), moonlight_suffusion(6), i_did_that, flask_of_alchemical_chaos_haste
2:05.483Ystarfire
[st]
Fluffy_Pillow 32.4/100 32% AP balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, starlord(3), warrior_of_elune, gathering_moonlight(3), moonlight_suffusion(6), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
2:06.405Umoonfire
[st]
Fluffy_Pillow 55.0/100 55% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, starlord(3), gathering_moonlight(4), moonlight_suffusion(6), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
2:07.327Vstarsurge
[st]
Fluffy_Pillow 70.0/100 70% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, starlord(3), gathering_moonlight(4), charged_bolts, i_did_that, flask_of_alchemical_chaos_mastery
2:08.289Ystarfire
[st]
Fluffy_Pillow 42.5/100 43% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, starlord(3), gathering_moonlight(4), charged_bolts, i_did_that, flask_of_alchemical_chaos_mastery
2:09.731Vstarsurge
[st]
Fluffy_Pillow 54.5/100 55% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, starlord(3), umbral_embrace, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:10.692Ystarfire
[st]
Fluffy_Pillow 20.5/100 21% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, starlord(3), umbral_embrace, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:12.135Jwrath
[st]
Fluffy_Pillow 32.5/100 33% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, umbral_inspiration, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:13.212Nfury_of_elune
[st]
Fluffy_Pillow 40.5/100 41% AP dreamstate(2), starlord, umbral_inspiration, lunar_amplification, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_mastery
2:14.351Qwrath
[st]
Fluffy_Pillow 45.5/100 46% AP dreamstate(2), fury_of_elune, starlord, umbral_inspiration, gathering_moonlight, moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_mastery
2:15.107Sstarsurge
[st]
Fluffy_Pillow 56.0/100 56% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord, umbral_embrace, umbral_inspiration, lunar_amplification, gathering_moonlight, moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_mastery
2:16.246Ystarfire
[st]
Fluffy_Pillow 27.5/100 28% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(2), umbral_embrace, umbral_inspiration, gathering_moonlight, moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_mastery
2:17.235Sstarsurge
[st]
Fluffy_Pillow 48.5/100 49% AP balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(2), umbral_inspiration, gathering_moonlight, moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:18.332Ystarfire
[st]
Fluffy_Pillow 17.5/100 18% AP balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:19.919Tsunfire
[st]
Fluffy_Pillow 47.0/100 47% AP balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight(2), moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:20.979Vstarsurge
[st]
Fluffy_Pillow 62.0/100 62% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), umbral_inspiration, lunar_amplification, gathering_moonlight(2), moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:22.037Ystarfire
[st]
Fluffy_Pillow 34.5/100 35% AP balance_of_all_things_arcane(3), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:23.622Vstarsurge
[st]
Fluffy_Pillow 50.5/100 51% AP balance_of_all_things_arcane(2), eclipse_lunar, parting_skies, starlord(3), gathering_moonlight(2), moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:24.680Ystarfire
[st]
Fluffy_Pillow 16.5/100 17% AP balance_of_all_things_arcane, eclipse_lunar, parting_skies, starlord(3), gathering_moonlight(2), moonlight_suffusion(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:26.266Ystarfire
[st]
Fluffy_Pillow 28.5/100 29% AP eclipse_lunar, parting_skies, starlord(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
2:27.851Sstarsurge
[st]
Fluffy_Pillow 40.5/100 41% AP eclipse_lunar, parting_skies, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:29.035Jwrath
[st]
Fluffy_Pillow 6.5/100 7% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(2), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:30.132Qwrath
[st]
Fluffy_Pillow 24.0/100 24% AP dreamstate(2), fury_of_elune, parting_skies, starlord(2), lunar_amplification, gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:30.887Umoonfire
[st]
Fluffy_Pillow 34.5/100 35% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(2), lunar_amplification(2), gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:31.986Sstarsurge
[st]
Fluffy_Pillow 58.7/100 59% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord(2), gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:33.083Ystarfire
[st]
Fluffy_Pillow 25.9/100 26% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:34.036Nfury_of_elune
[st]
Fluffy_Pillow 43.1/100 43% AP balance_of_all_things_arcane(7), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:35.095Vstarsurge
[st]
Fluffy_Pillow 51.3/100 51% AP balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:36.154Ystarfire
[st]
Fluffy_Pillow 21.5/100 22% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
2:37.740Tsunfire
[st]
Fluffy_Pillow 42.8/100 43% AP balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, sundered_firmament, starlord(3), gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_crit
2:38.799Vstarsurge
[st]
Fluffy_Pillow 61.6/100 62% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, starlord(3), lunar_amplification, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
2:39.857Ystarfire
[st]
Fluffy_Pillow 30.6/100 31% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, starlord(3), gathering_moonlight(2), moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
2:41.443Vstarsurge
[st]
Fluffy_Pillow 52.1/100 52% AP eclipse_lunar, fury_of_elune, starlord(3), umbral_embrace, gathering_moonlight(2), moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
2:42.503Ystarfire
[st]
Fluffy_Pillow 27.1/100 27% AP eclipse_lunar, starlord(3), umbral_embrace, gathering_moonlight(2), moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_crit
2:44.087Sstarsurge
[st]
Fluffy_Pillow 41.1/100 41% AP eclipse_lunar, umbral_inspiration, gathering_moonlight(3), moonlight_suffusion(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit
2:45.271Hwarrior_of_elune
[st]
Fluffy_Pillow 5.1/100 5% AP eclipse_lunar, starlord(2), umbral_inspiration, gathering_moonlight(3), moonlight_suffusion(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit
2:45.271Jwrath
[st]
Fluffy_Pillow 5.1/100 5% AP eclipse_lunar, starlord(2), umbral_inspiration, warrior_of_elune(3), gathering_moonlight(4), moonlight_suffusion(3), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit
2:46.368Qwrath
[st]
Fluffy_Pillow 13.1/100 13% AP dreamstate(2), starlord(2), umbral_inspiration, warrior_of_elune(3), lunar_amplification, gathering_moonlight(4), charged_bolts, i_did_that, astral_antenna_orb, flask_of_alchemical_chaos_crit
2:47.123Ystarfire
[st]
Fluffy_Pillow 21.1/100 21% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(2), umbral_inspiration, warrior_of_elune(3), lunar_amplification(2), gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_crit
2:47.877Wstarsurge
[st]
Fluffy_Pillow 36.7/100 37% AP balance_of_all_things_arcane(10), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune(2), gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
2:48.936Ystarfire
[st]
Fluffy_Pillow 4.7/100 5% AP balance_of_all_things_arcane(9), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune(2), gathering_moonlight(5), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
2:49.995Ystarfire
[st]
Fluffy_Pillow 22.3/100 22% AP balance_of_all_things_arcane(8), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, warrior_of_elune, gathering_moonlight(5), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
2:51.054Umoonfire
[st]
Fluffy_Pillow 39.9/100 40% AP balance_of_all_things_arcane(6), eclipse_lunar, parting_skies, solstice, starlord(3), gathering_moonlight(6), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
2:52.114Wstarsurge
[st]
Fluffy_Pillow 47.9/100 48% AP balance_of_all_things_arcane(5), eclipse_lunar, parting_skies, solstice, starlord(3), gathering_moonlight(6), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
2:53.173Nfury_of_elune
[st]
Fluffy_Pillow 11.9/100 12% AP balance_of_all_things_arcane(4), eclipse_lunar, parting_skies, starlord(3), gathering_moonlight(6), i_did_that, mitey_feast, astral_antenna, astral_antenna_orb(2), flask_of_alchemical_chaos_crit
2:54.232Ystarfire
[st]
Fluffy_Pillow 16.9/100 17% AP balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), moonlight_suffusion(6), i_did_that, mitey_feast, astral_antenna, astral_antenna_orb(2), flask_of_alchemical_chaos_crit
2:55.819Tsunfire
[st]
Fluffy_Pillow 38.4/100 38% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), moonlight_suffusion(6), i_did_that, mitey_feast, astral_antenna(2), astral_antenna_orb, flask_of_alchemical_chaos_crit
2:56.877Ystarfire
[st]
Fluffy_Pillow 51.4/100 51% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, parting_skies, starlord(3), lunar_amplification, moonlight_suffusion(6), i_did_that, mitey_feast, astral_antenna(2), astral_antenna_orb, flask_of_alchemical_chaos_crit
2:58.462Xstarsurge
[st]
Fluffy_Pillow 80.9/100 81% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
2:59.520Sstarsurge
[st]
Fluffy_Pillow 49.9/100 50% AP eclipse_lunar, fury_of_elune, parting_skies, gathering_moonlight, moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:00.705Ystarfire
[st]
Fluffy_Pillow 23.4/100 23% AP eclipse_lunar, fury_of_elune, parting_skies, starlord, gathering_moonlight(2), moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:02.413Qwrath
[st]
Fluffy_Pillow 43.9/100 44% AP dreamstate(2), parting_skies, starlord, gathering_moonlight(2), moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:03.167Qwrath
[st]
Fluffy_Pillow 63.9/100 64% AP dreamstate, parting_skies, starlord, lunar_amplification(2), gathering_moonlight(2), moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:03.921Sstarsurge
[st]
Fluffy_Pillow 71.9/100 72% AP balance_of_all_things_arcane(10), eclipse_lunar, sundered_firmament, solstice, starlord, lunar_amplification(3), gathering_moonlight(2), moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:05.060Sstarsurge
[st]
Fluffy_Pillow 37.1/100 37% AP balance_of_all_things_arcane(9), eclipse_lunar, sundered_firmament, solstice, starlord(2), gathering_moonlight(2), moonlight_suffusion(6), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_crit
3:06.158Ystarfire
[st]
Fluffy_Pillow 4.3/100 4% AP balance_of_all_things_arcane(8), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_crit
3:07.743Ystarfire
[st]
Fluffy_Pillow 24.1/100 24% AP balance_of_all_things_arcane(7), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:09.263Wstarsurge
[st]
Fluffy_Pillow 37.9/100 38% AP balance_of_all_things_arcane(5), eclipse_lunar, sundered_firmament, solstice, starlord(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:10.277Ystarfire
[st]
Fluffy_Pillow 5.1/100 5% AP balance_of_all_things_arcane(4), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:11.799Ystarfire
[st]
Fluffy_Pillow 18.9/100 19% AP balance_of_all_things_arcane(3), eclipse_lunar, sundered_firmament, starlord(3), gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:13.317Tsunfire
[st]
Fluffy_Pillow 37.5/100 38% AP balance_of_all_things_arcane, eclipse_lunar, starlord(3), gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:14.331Nfury_of_elune
[st]
Fluffy_Pillow 43.5/100 44% AP eclipse_lunar, starlord(3), lunar_amplification, gathering_moonlight(3), i_did_that, mitey_feast(2), flask_of_alchemical_chaos_haste
3:15.345Sstarsurge
[st]
Fluffy_Pillow 48.5/100 49% AP eclipse_lunar, fury_of_elune, moonlight_suffusion(3), i_did_that, mitey_feast(2), flask_of_alchemical_chaos_haste
3:16.481Mmoonfire
[st]
Fluffy_Pillow 17.5/100 18% AP eclipse_lunar, fury_of_elune, starlord, moonlight_suffusion(3), i_did_that, mitey_feast(2), flask_of_alchemical_chaos_haste
3:17.573Ystarfire
[st]
Fluffy_Pillow 30.5/100 31% AP eclipse_lunar, fury_of_elune, starlord, moonlight_suffusion(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:19.209Qwrath
[st]
Fluffy_Pillow 60.0/100 60% AP dreamstate(2), fury_of_elune, starlord, moonlight_suffusion(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:19.963Qwrath
[st]
Fluffy_Pillow 73.0/100 73% AP dreamstate, fury_of_elune, starlord(2), umbral_embrace, lunar_amplification, moonlight_suffusion(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:20.717Sstarsurge
[st]
Fluffy_Pillow 83.5/100 84% AP balance_of_all_things_arcane(10), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(2), umbral_embrace, lunar_amplification(2), gathering_moonlight, moonlight_suffusion(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:21.768Rstarsurge
[st]
Fluffy_Pillow 56.5/100 57% AP balance_of_all_things_arcane(9), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:22.781Ystarfire
[st]
Fluffy_Pillow 33.5/100 34% AP balance_of_all_things_arcane(8), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:24.300Rstarsurge
[st]
Fluffy_Pillow 47.5/100 48% AP balance_of_all_things_arcane(7), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:25.312Ystarfire
[st]
Fluffy_Pillow 11.5/100 12% AP balance_of_all_things_arcane(6), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:26.831Ystarfire
[st]
Fluffy_Pillow 25.5/100 26% AP balance_of_all_things_arcane(4), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:28.350Rstarsurge
[st]
Fluffy_Pillow 37.5/100 38% AP balance_of_all_things_arcane(3), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
3:29.363Ystarfire
[st]
Fluffy_Pillow 1.5/100 2% AP balance_of_all_things_arcane(2), eclipse_lunar, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb(2), flask_of_alchemical_chaos_haste
3:30.884Lsunfire
[st]
Fluffy_Pillow 15.5/100 16% AP eclipse_lunar, parting_skies, umbral_embrace, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb(2), flask_of_alchemical_chaos_haste
3:32.016Ystarfire
[st]
Fluffy_Pillow 23.5/100 24% AP eclipse_lunar, parting_skies, starlord, umbral_embrace, lunar_amplification, gathering_moonlight(4), charged_bolts, i_did_that, mitey_feast, astral_antenna_orb(2), flask_of_alchemical_chaos_haste
3:33.652Ystarfire
[st]
Fluffy_Pillow 35.5/100 36% AP eclipse_lunar, parting_skies, starlord, umbral_inspiration, gathering_moonlight(5), charged_bolts, i_did_that, mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_haste
3:35.289Ifury_of_elune
[st]
Fluffy_Pillow 49.5/100 50% AP eclipse_lunar, parting_skies, starlord, umbral_inspiration, gathering_moonlight(5), charged_bolts, i_did_that, mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_haste
3:36.380Pincarnation_chosen_of_elune
[st]
Fluffy_Pillow 58.5/100 59% AP dreamstate(2), fury_of_elune, parting_skies, starlord(2), umbral_inspiration, moonlight_suffusion(5), charged_bolts, i_did_that, mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_haste
3:36.380Sstarsurge
[st]
Fluffy_Pillow 58.5/100 59% AP balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(2), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), charged_bolts, i_did_that, mitey_feast, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_haste
3:37.336Umoonfire
[st]
Fluffy_Pillow 28.1/100 28% AP balance_of_all_things_arcane(10), balance_of_all_things_nature(10), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), charged_bolts, i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_mastery
3:38.300Wstarsurge
[st]
Fluffy_Pillow 46.3/100 46% AP balance_of_all_things_arcane(9), balance_of_all_things_nature(9), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_mastery
3:39.262Ystarfire
[st]
Fluffy_Pillow 16.0/100 16% AP balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, dreamstate(2), eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_mastery
3:40.129Wstarsurge
[st]
Fluffy_Pillow 36.2/100 36% AP balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_mastery
3:41.092Ystarfire
[st]
Fluffy_Pillow 8.4/100 8% AP balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, dreamstate, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna(2), flask_of_alchemical_chaos_mastery
3:41.959Hwarrior_of_elune
[st]
Fluffy_Pillow 28.6/100 29% AP balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), gathering_moonlight(2), moonlight_suffusion(5), i_did_that, mitey_feast(2), astral_antenna(2), flask_of_alchemical_chaos_mastery
3:41.959Ystarfire
[st]
Fluffy_Pillow 28.6/100 29% AP balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, solstice, starlord(3), warrior_of_elune(3), gathering_moonlight(2), moonlight_suffusion(5), i_did_that, mitey_feast(2), astral_antenna(2), flask_of_alchemical_chaos_mastery
3:42.921Vstarsurge
[st]
Fluffy_Pillow 52.4/100 52% AP balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, sundered_firmament, parting_skies, starlord(3), umbral_embrace, warrior_of_elune(2), gathering_moonlight(2), moonlight_suffusion(5), i_did_that, mitey_feast(2), astral_antenna, flask_of_alchemical_chaos_mastery
3:43.884Ystarfire
[st]
Fluffy_Pillow 28.1/100 28% AP balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, sundered_firmament, parting_skies, starlord(3), umbral_embrace, warrior_of_elune(2), gathering_moonlight(3), moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
3:44.846Vstarsurge
[st]
Fluffy_Pillow 50.3/100 50% AP balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), umbral_inspiration, warrior_of_elune, gathering_moonlight(3), moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
3:45.807Ystarfire
[st]
Fluffy_Pillow 18.3/100 18% AP balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord(3), umbral_inspiration, warrior_of_elune, gathering_moonlight(4), moonlight_suffusion(5), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_mastery
3:46.771Ystarfire
[st]
Fluffy_Pillow 33.9/100 34% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, umbral_inspiration, gathering_moonlight(4), moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:48.385Sstarsurge
[st]
Fluffy_Pillow 45.9/100 46% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, umbral_inspiration, gathering_moonlight(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:49.461Tsunfire
[st]
Fluffy_Pillow 9.9/100 10% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord, umbral_inspiration, gathering_moonlight(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:50.498Ystarfire
[st]
Fluffy_Pillow 17.9/100 18% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord, lunar_amplification, gathering_moonlight(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:52.050Jwrath
[st]
Fluffy_Pillow 29.9/100 30% AP incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, parting_skies, starlord, umbral_embrace, gathering_moonlight(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:53.086Nfury_of_elune
[st]
Fluffy_Pillow 40.4/100 40% AP dreamstate(2), fury_of_elune, parting_skies, starlord(2), umbral_embrace, lunar_amplification, gathering_moonlight(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:54.183Qwrath
[st]
Fluffy_Pillow 47.4/100 47% AP dreamstate(2), fury_of_elune, parting_skies, starlord(2), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:54.938Sstarsurge
[st]
Fluffy_Pillow 59.9/100 60% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(2), umbral_embrace, lunar_amplification, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:56.037Wstarsurge
[st]
Fluffy_Pillow 38.1/100 38% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:57.096Umoonfire
[st]
Fluffy_Pillow 14.8/100 15% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:58.154Ystarfire
[st]
Fluffy_Pillow 31.0/100 31% AP balance_of_all_things_arcane(7), dreamstate, eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_embrace, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
3:59.109Vstarsurge
[st]
Fluffy_Pillow 53.2/100 53% AP balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:00.166Ystarfire
[st]
Fluffy_Pillow 23.4/100 23% AP balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, sundered_firmament, solstice, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:01.751Ystarfire
[st]
Fluffy_Pillow 48.2/100 48% AP balance_of_all_things_arcane(4), eclipse_lunar, sundered_firmament, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:03.337Vstarsurge
[st]
Fluffy_Pillow 77.5/100 78% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:04.398Sstarsurge
[st]
Fluffy_Pillow 46.5/100 47% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, umbral_inspiration, gathering_moonlight(2), moonlight_suffusion(5), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:05.582Ystarfire
[st]
Fluffy_Pillow 23.0/100 23% AP eclipse_lunar, starlord, gathering_moonlight(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_mastery
4:07.290Tsunfire
[st]
Fluffy_Pillow 35.0/100 35% AP eclipse_lunar, starlord, gathering_moonlight(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:08.383Sstarsurge
[st]
Fluffy_Pillow 41.0/100 41% AP eclipse_lunar, starlord(2), lunar_amplification, gathering_moonlight(2), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:09.432Jwrath
[st]
Fluffy_Pillow 5.0/100 5% AP eclipse_lunar, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:10.446Qwrath
[st]
Fluffy_Pillow 13.0/100 13% AP dreamstate(2), starlord(3), lunar_amplification, gathering_moonlight(3), i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:11.199Ystarfire
[st]
Fluffy_Pillow 21.0/100 21% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(3), lunar_amplification(2), gathering_moonlight(3), i_did_that, mitey_feast(2), astral_antenna_orb, flask_of_alchemical_chaos_haste
4:12.111Ystarfire
[st]
Fluffy_Pillow 35.0/100 35% AP balance_of_all_things_arcane(9), eclipse_lunar, parting_skies, solstice, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:13.632Nfury_of_elune
[st]
Fluffy_Pillow 53.0/100 53% AP balance_of_all_things_arcane(8), eclipse_lunar, parting_skies, solstice, starlord(3), gathering_moonlight(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:14.646Vstarsurge
[st]
Fluffy_Pillow 60.0/100 60% AP balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:15.660Ystarfire
[st]
Fluffy_Pillow 39.0/100 39% AP balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, parting_skies, solstice, starlord(3), lunar_amplification, gathering_moonlight, moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:17.181Vstarsurge
[st]
Fluffy_Pillow 60.5/100 61% AP balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:18.194Ystarfire
[st]
Fluffy_Pillow 29.5/100 30% AP balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, parting_skies, starlord(3), gathering_moonlight, moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:19.713Sstarsurge
[st]
Fluffy_Pillow 48.5/100 49% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, parting_skies, gathering_moonlight(2), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:20.848Umoonfire
[st]
Fluffy_Pillow 17.5/100 18% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, parting_skies, starlord, gathering_moonlight(2), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:21.941Sstarsurge
[st]
Fluffy_Pillow 42.5/100 43% AP eclipse_lunar, parting_skies, starlord, gathering_moonlight(2), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:23.032Ystarfire
[st]
Fluffy_Pillow 6.5/100 7% AP eclipse_lunar, parting_skies, starlord(2), gathering_moonlight(2), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:24.607Tsunfire
[st]
Fluffy_Pillow 18.5/100 19% AP eclipse_lunar, parting_skies, starlord(2), gathering_moonlight(2), moonlight_suffusion(3), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:25.659Jwrath
[st]
Fluffy_Pillow 26.5/100 27% AP eclipse_lunar, parting_skies, starlord(2), lunar_amplification, gathering_moonlight(2), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:26.710Qwrath
[st]
Fluffy_Pillow 36.5/100 37% AP dreamstate(2), parting_skies, starlord(2), lunar_amplification(2), gathering_moonlight(2), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:27.464Sstarsurge
[st]
Fluffy_Pillow 54.5/100 55% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord(2), umbral_embrace, lunar_amplification(3), gathering_moonlight(2), i_did_that, mitey_feast, astral_antenna, flask_of_alchemical_chaos_haste
4:28.516Ystarfire
[st]
Fluffy_Pillow 19.7/100 20% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_embrace, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:29.430Hwarrior_of_elune
[st]
Fluffy_Pillow 34.9/100 35% AP balance_of_all_things_arcane(8), eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_inspiration, gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:29.430Ystarfire
[st]
Fluffy_Pillow 34.9/100 35% AP balance_of_all_things_arcane(8), eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_inspiration, warrior_of_elune(3), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:30.442Wstarsurge
[st]
Fluffy_Pillow 53.7/100 54% AP balance_of_all_things_arcane(7), eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_embrace, umbral_inspiration, warrior_of_elune(2), gathering_moonlight(2), charged_bolts, i_did_that, mitey_feast, flask_of_alchemical_chaos_haste
4:31.458Ystarfire
[st]
Fluffy_Pillow 18.9/100 19% AP balance_of_all_things_arcane(6), eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_embrace, umbral_inspiration, warrior_of_elune(2), gathering_moonlight(2), charged_bolts, mitey_feast, flask_of_alchemical_chaos_haste
4:32.472Nfury_of_elune
[st]
Fluffy_Pillow 37.7/100 38% AP balance_of_all_things_arcane(5), eclipse_lunar, sundered_firmament, solstice, starlord(3), umbral_embrace, umbral_inspiration, warrior_of_elune, gathering_moonlight(2), charged_bolts, mitey_feast, flask_of_alchemical_chaos_haste
4:33.644Ystarfire
[st]
Fluffy_Pillow 45.9/100 46% AP balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, sundered_firmament, starlord(3), umbral_embrace, umbral_inspiration, warrior_of_elune, moonlight_suffusion(2), charged_bolts, mitey_feast, flask_of_alchemical_chaos_haste
4:34.659Xstarsurge
[st]
Fluffy_Pillow 69.7/100 70% AP balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, sundered_firmament, starlord(3), umbral_inspiration, moonlight_suffusion(2), charged_bolts, mitey_feast, flask_of_alchemical_chaos_haste
4:35.673Sstarsurge
[st]
Fluffy_Pillow 45.9/100 46% AP balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, mitey_feast, flask_of_alchemical_chaos_haste
4:36.807Ystarfire
[st]
Fluffy_Pillow 14.9/100 15% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, starlord, umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:38.444Ystarfire
[st]
Fluffy_Pillow 34.4/100 34% AP eclipse_lunar, fury_of_elune, starlord, umbral_inspiration, gathering_moonlight, moonlight_suffusion(2), charged_bolts, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:40.079Sstarsurge
[st]
Fluffy_Pillow 53.9/100 54% AP eclipse_lunar, fury_of_elune, starlord(2), umbral_embrace, gathering_moonlight, moonlight_suffusion(2), charged_bolts, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:41.129Umoonfire
[st]
Fluffy_Pillow 28.9/100 29% AP eclipse_lunar, starlord(3), umbral_embrace, gathering_moonlight(2), moonlight_suffusion(2), charged_bolts, mitey_feast, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:42.142Jwrath
[st]
Fluffy_Pillow 36.9/100 37% AP eclipse_lunar, starlord(3), umbral_embrace, gathering_moonlight(3), moonlight_suffusion(2), charged_bolts, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:43.156Qwrath
[st]
Fluffy_Pillow 44.9/100 45% AP dreamstate(2), starlord(3), umbral_embrace, lunar_amplification, gathering_moonlight(3), moonlight_suffusion(2), charged_bolts, astral_antenna_orb, flask_of_alchemical_chaos_haste
4:43.910Tsunfire
[st]
Fluffy_Pillow 52.9/100 53% AP balance_of_all_things_arcane(10), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(3), umbral_embrace, lunar_amplification(2), gathering_moonlight(3), moonlight_suffusion(2), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:44.923Wstarsurge
[st]
Fluffy_Pillow 60.9/100 61% AP balance_of_all_things_arcane(9), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(3), umbral_embrace, lunar_amplification(3), gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:45.935Ystarfire
[st]
Fluffy_Pillow 28.9/100 29% AP balance_of_all_things_arcane(8), dreamstate, eclipse_lunar, parting_skies, solstice, starlord(3), umbral_embrace, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:46.847Ystarfire
[st]
Fluffy_Pillow 44.9/100 45% AP balance_of_all_things_arcane(7), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:48.366Ystarfire
[st]
Fluffy_Pillow 60.9/100 61% AP balance_of_all_things_arcane(6), eclipse_lunar, parting_skies, solstice, starlord(3), umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:49.885Xstarsurge
[st]
Fluffy_Pillow 76.9/100 77% AP balance_of_all_things_arcane(4), eclipse_lunar, parting_skies, starlord(3), umbral_embrace, umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:50.898Sstarsurge
[st]
Fluffy_Pillow 40.9/100 41% AP balance_of_all_things_arcane(3), eclipse_lunar, parting_skies, umbral_embrace, umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:52.032Ifury_of_elune
[st]
Fluffy_Pillow 6.9/100 7% AP balance_of_all_things_arcane(2), eclipse_lunar, parting_skies, starlord, umbral_embrace, umbral_inspiration, gathering_moonlight(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:53.125Ystarfire
[st]
Fluffy_Pillow 11.9/100 12% AP balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, parting_skies, starlord, umbral_embrace, moonlight_suffusion(3), charged_bolts, i_did_that, astral_antenna, flask_of_alchemical_chaos_haste
4:54.762Ystarfire
[st]
Fluffy_Pillow 31.4/100 31% AP eclipse_lunar, fury_of_elune, parting_skies, starlord, umbral_inspiration, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
4:56.398Sstarsurge
[st]
Fluffy_Pillow 50.9/100 51% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(2), umbral_inspiration, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
4:57.449Ystarfire
[st]
Fluffy_Pillow 21.9/100 22% AP eclipse_lunar, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
4:58.969Qwrath
[st]
Fluffy_Pillow 41.4/100 41% AP dreamstate(2), fury_of_elune, parting_skies, starlord(3), umbral_inspiration, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste
4:59.721Qwrath
[st]
Fluffy_Pillow 54.4/100 54% AP dreamstate, fury_of_elune, parting_skies, starlord(3), umbral_inspiration, lunar_amplification, gathering_moonlight, moonlight_suffusion(3), charged_bolts, i_did_that, flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength7588-2758675860
Agility17647217649176490
Stamina864520660146628711518078
Intellect17647011567811107288136 (56402)
Spirit00000
Health13202920125742200
Mana250000025000000
Rage1001000
Energy1001000
Astral Power1001000
Combo Points550
Spell Power1156781110720
Crit10.73%11.15%4303
Haste35.13%27.48%17307
Versatility7.95%0.50%388
Mana Regen25600256000
Mastery21.40%20.59%23474
Armor379983799837998
Run Speed80842

Gear

Source Slot Average Item Level: 698.00
Local Head Skymane of the Mother Eagle
ilevel: 701, stats: { 5,036 Armor, +53,081 Sta, +1,849 Haste, +742 Mastery, +6,761 AgiInt }
Local Neck Gobfather's Gifted Bling
ilevel: 665, stats: { +19,079 Sta, +1,343 Haste, +5,890 Mastery }, gems: { +147 Mastery, +49 Haste, +147 Mastery, +49 Haste }
Local Shoulders Ritual Pauldrons of the Mother Eagle
ilevel: 710, stats: { 4,930 Armor, +44,477 Sta, +1,387 Haste, +618 Vers, +5,515 AgiInt }
Local Shirt Precious's Ribbon
ilevel: 1
item effects: { equip: }
Local Chest Vest of the Mother Eagle
ilevel: 710, stats: { 7,171 Armor, +59,302 Sta, +889 Haste, +1,784 Mastery, +7,353 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Durable Information Securing Container
ilevel: 701, stats: { 3,777 Armor, +39,811 Sta, +5,071 StrAgiInt }, gems: { +147 Mastery, +49 Haste }
item effects: { equip: Durable Information Securing Container, equip: Durable Information Securing Container, use: , equip: Durable Information Securing Container }
Local Legs Breeches of the Mother Eagle
ilevel: 710, stats: { 6,274 Armor, +59,302 Sta, +1,766 Crit, +908 Mastery, +7,353 AgiInt }, enchant: { +930 Int, +895 Sta (sunset_spellthread_3) }
Local Feet Umbral Stalker's Footpads
ilevel: 688, stats: { 3,825 Armor, +33,956 Sta, +727 Crit, +1,127 Mastery, +4,493 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Bindings of Lost Essence
ilevel: 691, stats: { 3,125 Armor, +26,443 Sta, +987 Crit, +419 Haste, +3,465 AgiInt }
Local Hands Wings of the Mother Eagle
ilevel: 704, stats: { 3,860 Armor, +41,330 Sta, +591 Crit, +1,373 Mastery, +5,215 AgiInt, +842 RunSpeed }
Local Finger1 Whispers of K'aresh
ilevel: 697, stats: { +28,436 Sta, +5,155 Haste, +3,436 Mastery }, gems: { +147 Mastery, +49 Haste }, enchant: { +-115 Vers, +390 Haste (cursed_haste_3) }
Local Finger2 The Jastor Diamond
ilevel: 658, stats: { +17,449 Sta, +1,050 Haste, +5,886 Mastery }, enchant: { +-115 Vers, +390 Haste (cursed_haste_3) }
item effects: { equip: The Jastor Diamond, equip: The Jastor Diamond }
Local Trinket1 Azhiccaran Parapodia
ilevel: 704, stats: { +1,870 Haste }
item effects: { equip: Azhiccaran Parapodia }
Local Trinket2 Astral Antenna
ilevel: 697, stats: { +6,193 StrAgiInt }
item effects: { equip: Astral Antenna }
Local Back Reshii Wraps
ilevel: 730, stats: { +40,541 Sta, +4,983 StrAgiInt, +1,286 Haste }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
item effects: { equip: Ethereal Energy }
Local Main Hand Staff of Fractured Spacetime
ilevel: 701, weapon: { 7,786 - 10,536, 3.6 }, stats: { +6,761 Int, +23,298 Int, +53,081 Sta, +851 Haste, +1,740 Mastery }, enchant: authority_of_the_depths_3, temporary_enchant: Algari Mana Oil

Talents

Talent Tables

Druid Talents [31]
1
2
3
4
5
6
7
8
9
10
Balance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="Nêphôr"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/n%C3%AAph%C3%B4r"
spec=balance
level=80
race=night_elf
timeofday=night
role=spell
position=back
talents=CYGAkuH5GdQpDrgY32rlVGnyqBAAAAAAAAAAAAAAAAAALUmtGGzMAzCLzMzCDjFzyMLzMbzMzMzMLmlxwgNswAMW2mZDjZbEYKAAEALmZMAbGzYA
shadowlands.soleahs_secret_technique_type_override=mastery

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_midnight_masquerade
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_use_buff
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_use_buff)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/starfire,if=!talent.stellar_flare
actions.precombat+=/stellar_flare

# Executed every time the actor is available.
actions=variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+((talent.bounteous_bloom&buff.bounteous_bloom.up)*15)+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*24
actions+=/variable,name=ca_effective_cd,value=cooldown.ca_inc.remains<?cooldown.force_of_nature.remains
actions+=/variable,name=pre_cd_condition,value=(!talent.whirling_stars|!talent.convoke_the_spirits|cooldown.convoke_the_spirits.remains<gcd.max*2|fight_remains<cooldown.convoke_the_spirits.remains+3|cooldown.convoke_the_spirits.remains>cooldown.ca_inc.full_recharge_time+15*talent.control_of_the_dream)&(variable.on_use_trinket=0|(variable.on_use_trinket=1|variable.on_use_trinket=3)&(trinket.1.cooldown.remains>cooldown.ca_inc.full_recharge_time+(15*talent.control_of_the_dream)|!talent.convoke_the_spirits&hero_tree.elunes_chosen&(trinket.1.cooldown.duration<=100&trinket.1.cooldown.remains>cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration|trinket.1.cooldown.duration>=100&cooldown.ca_inc.charges_fractional=1&(trinket.1.cooldown.duration>?cooldown.ca_inc.full_recharge_time))|talent.convoke_the_spirits&(cooldown.convoke_the_spirits.remains<3&(ceil((fight_remains-10)%cooldown.convoke_the_spirits.duration)>ceil((fight_remains-trinket.1.cooldown.remains-10)%cooldown.convoke_the_spirits.duration))|cooldown.convoke_the_spirits.remains>trinket.1.cooldown.remains&cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration<trinket.1.cooldown.remains+15)|trinket.1.cooldown.remains+6>fight_remains|trinket.1.cooldown.ready)|variable.on_use_trinket=2&(trinket.2.cooldown.remains>cooldown.ca_inc.full_recharge_time+(15*talent.control_of_the_dream)|!talent.convoke_the_spirits&hero_tree.elunes_chosen&(trinket.2.cooldown.duration<=100&trinket.2.cooldown.remains>cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration|trinket.2.cooldown.duration>=100&cooldown.ca_inc.charges_fractional=1&(trinket.2.cooldown.duration>?cooldown.ca_inc.full_recharge_time))|talent.convoke_the_spirits&(cooldown.convoke_the_spirits.remains<3&(ceil((fight_remains-10)%cooldown.convoke_the_spirits.duration)>ceil((fight_remains-trinket.2.cooldown.remains-10)%cooldown.convoke_the_spirits.duration))|cooldown.convoke_the_spirits.remains>trinket.2.cooldown.remains&cooldown.ca_inc.full_recharge_time-cooldown.ca_inc.duration<trinket.2.cooldown.remains+15)|trinket.2.cooldown.remains+6>fight_remains|trinket.2.cooldown.ready))&cooldown.ca_inc.remains<gcd.max&!buff.ca_inc.up
actions+=/variable,name=cd_condition,value=variable.pre_cd_condition&(fight_remains<(15+5*talent.incarnation_chosen_of_elune)*(1-talent.whirling_stars*0.2)|target.time_to_die>10&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up))
actions+=/variable,name=convoke_condition,value=fight_remains<4+gcd.max|(buff.ca_inc.up|cooldown.ca_inc.remains>40)&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up|cooldown.force_of_nature.remains>15)
actions+=/variable,name=eclipse_remains,value=buff.eclipse_lunar.remains<?buff.eclipse_solar.remains
actions+=/variable,name=enter_lunar,value=talent.lunar_calling|spell_targets.starfire>3-(talent.umbral_intensity|talent.soul_of_the_forest)
actions+=/variable,name=boat_stacks,value=buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack
actions+=/variable,name=tww3_keeper_4pc,value=hero_tree.keeper_of_the_grove&set_bonus.tww3_4pc
actions+=/variable,name=kotg_single_ca_condition,value=variable.tww3_keeper_4pc&!buff.ca_inc.up&cooldown.ca_inc.ready&((variable.on_use_trinket=1&(trinket.1.cooldown.ready|fight_remains<trinket.1.cooldown.remains)|variable.on_use_trinket=2&(trinket.2.cooldown.ready|fight_remains<trinket.2.cooldown.remains)|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.2.cooldown.ready|fight_remains<(trinket.1.cooldown.remains>?trinket.2.cooldown.remains)))&(cooldown.convoke_the_spirits.remains<gcd.max*3-0.5|fight_remains<cooldown.convoke_the_spirits.remains|!talent.convoke_the_spirits)&(cooldown.force_of_nature.remains<gcd.max*2-0.3&!(fight_remains>cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration*0.3+gcd.max&fight_remains<cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+gcd.max*2))&(cooldown.ca_inc.full_recharge_time>20&fight_remains>(cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+2|fight_remains<cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration+gcd.max&!(fight_remains>cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration*0.3+gcd.max&cooldown.ca_inc.full_recharge_time>cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+gcd.max&fight_remains>cooldown.force_of_nature.remains+cooldown.force_of_nature.duration+buff.harmony_of_the_grove.duration+gcd.max)&!(!cooldown.potion.ready&fight_remains>cooldown.potion.remains+buff.harmony_of_the_grove.duration)|!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration*2+buff.dryad.duration+2&fight_remains>(cooldown.potion.remains+4+buff.dryad.duration+2+gcd.max<?cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max<?(cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.duration+(variable.on_use_trinket=2)*trinket.2.cooldown.duration+(variable.on_use_trinket=3)*(trinket.1.cooldown.duration>?trinket.2.cooldown.duration)+4+buff.dryad.duration+2+gcd.max))|fight_remains<buff.ca_inc.duration+gcd.max*(1+(dot.moonfire.remains<(3>?fight_remains)+dot.sunfire.remains<(buff.ca_inc.duration+gcd.max>?fight_remains)<?dot.sunfire.remains<(buff.ca_inc.duration>?fight_remains)+dot.moonfire.remains<(3+gcd.max>?fight_remains))))
actions+=/variable,name=kotg_double_ca_condition,value=variable.tww3_keeper_4pc&!buff.ca_inc.up&(variable.on_use_trinket=1&(trinket.1.cooldown.ready|trinket.1.proc.any_dps.up)|variable.on_use_trinket=2&(trinket.2.cooldown.ready|trinket.2.proc.any_dps.up)|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.1.proc.any_dps.up|trinket.2.cooldown.ready|trinket.2.proc.any_dps.up))&(cooldown.convoke_the_spirits.remains<gcd.max*2-0.3|!talent.convoke_the_spirits)&(cooldown.ca_inc.full_recharge_time<4+gcd.max*3&(cooldown.force_of_nature.ready|buff.harmony_of_the_grove.up|cooldown.force_of_nature.remains<gcd.max*3-0.5&fight_remains<cooldown.force_of_nature.remains+buff.dryad.duration+2+4+gcd.max*4)|(cooldown.ca_inc.full_recharge_time-gcd.max<?cooldown.force_of_nature.remains)<buff.dryad.duration&(fight_remains<cooldown.force_of_nature.remains+buff.dryad.duration+2+4+gcd.max*2|fight_remains<cooldown.ca_inc.full_recharge_time+buff.ca_inc.duration+gcd.max&fight_remains<cooldown.ca_inc.full_recharge_time-buff.dryad.duration-gcd.max))&!(!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration*2+buff.dryad.duration+2+gcd.max&fight_remains>(cooldown.potion.remains+buff.dryad.duration+2+gcd.max<?buff.dryad.duration+2+4+gcd.max*6)&(fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max|fight_remains>((cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.duration+(variable.on_use_trinket=2)*trinket.2.cooldown.duration+(variable.on_use_trinket=3)*(trinket.1.cooldown.duration>?trinket.2.cooldown.duration)+4+buff.dryad.duration+2+gcd.max)))
actions+=/variable,name=kotg_second_ca_condition,value=variable.tww3_keeper_4pc&buff.ca_inc.up&((buff.harmony_of_the_grove.up&(cooldown.convoke_the_spirits.remains>30|buff.harmony_of_the_grove.remains<gcd.max*2|buff.dryads_favor.up)&!(!cooldown.potion.ready&fight_remains<cooldown.ca_inc.full_recharge_time+cooldown.ca_inc.duration+buff.dryad.duration+2+gcd.max&fight_remains>(cooldown.potion.remains+buff.dryad.duration+2+gcd.max<?cooldown.ca_inc.full_recharge_time+buff.dryad.duration+2+gcd.max)&(fight_remains<cooldown.ca_inc.full_recharge_time+buff.dryad.duration+2+gcd.max|fight_remains>((cooldown.convoke_the_spirits.remains-gcd.max*5*talent.control_of_the_dream<?105)+gcd.max*6+4+buff.dryad.duration+2<?(variable.on_use_trinket=1)*trinket.1.cooldown.remains+(variable.on_use_trinket=2)*trinket.2.cooldown.remains+(variable.on_use_trinket=3)*(trinket.1.cooldown.remains>?trinket.2.cooldown.remains)+4+buff.dryad.duration+2+gcd.max))))|fight_remains<buff.dryad.duration+2+gcd.max)
actions+=/variable,name=kotg_inc_condition,value=variable.tww3_keeper_4pc&astral_power.deficit<=50&(variable.on_use_trinket=1&trinket.1.cooldown.ready|variable.on_use_trinket=2&trinket.2.cooldown.ready|variable.on_use_trinket=0|variable.on_use_trinket=3&(trinket.1.cooldown.ready|trinket.2.cooldown.ready)|(trinket.1.cooldown.remains>cooldown.force_of_nature.duration|trinket.2.cooldown.remains>cooldown.force_of_nature.duration)&cooldown.force_of_nature.remains<gcd.max*2)|fight_remains<(cooldown.ca_inc.full_recharge_time>?cooldown.force_of_nature.remains)
actions+=/variable,name=pool_for_cd,value=astral_power<(variable.kotg_single_ca_condition*action.starsurge.cost*2<?variable.kotg_double_ca_condition*(action.starsurge.cost*2-action.force_of_nature.energize_amount)<?(!buff.ca_inc.up&fight_remains>cooldown.ca_inc.remains+2+gcd.max&fight_remains<(fight_remains-cooldown.ca_inc.remains>?buff.ca_inc.duration)+5)*action.starsurge.cost*3<?(!buff.ca_inc.up&fight_remains>cooldown.ca_inc.full_recharge_time+2+gcd.max&fight_remains<(fight_remains-cooldown.ca_inc.full_recharge_time>?buff.ca_inc.duration)+4+8)*(action.starsurge.cost*3-action.force_of_nature.energize_amount*(cooldown.force_of_nature.ready)))
actions+=/variable,name=pool_in_ca,value=buff.dryad.up&fight_remains>buff.dryad.remains&cooldown.convoke_the_spirits.remains>buff.dryad.remains&(astral_power-action.starsurge.cost+(0<?floor((buff.dryad.remains+2-gcd.max*2-0.5)%action.wrath.execute_time))*action.wrath.energize_amount)<action.starsurge.cost*2
actions+=/use_item,name=imperfect_ascendancy_serum,if=dot.sunfire.remains>4&(dot.moonfire.remains>4|talent.treants_of_the_moon&(cooldown.force_of_nature.remains<3|buff.harmony_of_the_grove.up)&variable.ca_effective_cd<1|fight_remains<20|fight_remains<variable.ca_effective_cd&(buff.harmony_of_the_grove.up|cooldown.convoke_the_spirits.ready))&buff.spymasters_report.stack<=29
actions+=/variable,name=generic_trinket_condition,value=(buff.dryad.up|buff.ca_inc.up)|variable.no_cd_talent|fight_remains<variable.ca_effective_cd&(buff.harmony_of_the_grove.up|cooldown.convoke_the_spirits.ready)&!cooldown.ca_inc.ready|(buff.spymasters_report.stack+variable.ca_effective_cd%6)>29&variable.ca_effective_cd>20|variable.on_use_trinket=0
actions+=/use_item,slot=trinket1,if=!trinket.1.is.spymasters_web&!trinket.1.is.imperfect_ascendancy_serum&!trinket.1.is.treacherous_transmitter&!trinket.1.is.soulletting_ruby&(variable.on_use_trinket!=1&variable.on_use_trinket!=3&trinket.2.cooldown.remains>20|fight_remains<(20+20*(trinket.2.has_use&trinket.2.cooldown.remains<25))|variable.generic_trinket_condition)
actions+=/use_item,slot=trinket2,if=!trinket.2.is.spymasters_web&!trinket.2.is.imperfect_ascendancy_serum&!trinket.2.is.treacherous_transmitter&!trinket.2.is.soulletting_ruby&(variable.on_use_trinket<2&trinket.1.cooldown.remains>20|variable.on_use_trinket=3&trinket.1.cooldown.remains>20&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up|ceil((fight_remains-15)%trinket.2.cooldown.duration)>ceil((fight_remains-cooldown.force_of_nature.remains-15)%trinket.2.cooldown.duration))|fight_remains<(20+20*(trinket.1.has_use&trinket.1.cooldown.remains<25))|variable.generic_trinket_condition)
actions+=/use_items
actions+=/potion,if=fight_remains<=30
actions+=/invoke_external_buff,name=power_infusion,if=variable.cd_condition&!variable.tww3_keeper_4pc|variable.tww3_keeper_4pc&(variable.kotg_single_ca_condition|variable.kotg_double_ca_condition)
actions+=/berserking,if=variable.no_cd_talent|fight_remains<15
actions+=/run_action_list,name=kotg_st,if=variable.tww3_keeper_4pc&spell_targets=1
actions+=/run_action_list,name=st,if=!variable.tww3_keeper_4pc&spell_targets=1
actions+=/run_action_list,name=aoe,if=spell_targets>1

actions.aoe=starsurge,if=buff.dryads_favor.up
actions.aoe+=/wrath,if=variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time
actions.aoe+=/starfire,if=!variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time
actions.aoe+=/starfall,if=astral_power.deficit<=variable.passive_asp+6
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&(!talent.treants_of_the_moon|spell_targets-active_dot.moonfire_dmg>6|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up),if=fight_style.dungeonroute|fight_style.dungeonslice
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&(!talent.treants_of_the_moon|spell_targets-active_dot.moonfire_dmg>6|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up),if=!fight_style.dungeonroute&!fight_style.dungeonslice
actions.aoe+=/wrath,if=variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)&!variable.pre_cd_condition
actions.aoe+=/starfire,if=!variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-target>7+spell_targets),if=spell_targets<(11-talent.umbral_intensity.rank-(2*talent.astral_smolder)-talent.lunar_calling)
actions.aoe+=/force_of_nature,if=variable.pre_cd_condition|cooldown.ca_inc.full_recharge_time+5+15*talent.control_of_the_dream>cooldown&(!talent.convoke_the_spirits|cooldown.convoke_the_spirits.remains+10+15*talent.control_of_the_dream>cooldown|fight_remains<cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration+5)&(variable.on_use_trinket=0|(variable.on_use_trinket=1|variable.on_use_trinket=3)&(trinket.1.cooldown.remains>5+15*talent.control_of_the_dream|cooldown.ca_inc.remains>20|trinket.1.cooldown.ready)|variable.on_use_trinket=2&(trinket.2.cooldown.remains>5+15*talent.control_of_the_dream|cooldown.ca_inc.remains>20|trinket.2.cooldown.ready))&(fight_remains>cooldown+5|fight_remains<cooldown.ca_inc.remains+7)|talent.whirling_stars&talent.convoke_the_spirits&cooldown.convoke_the_spirits.remains>cooldown.force_of_nature.duration-10&fight_remains>cooldown.convoke_the_spirits.remains+6
actions.aoe+=/fury_of_elune,if=eclipse.in_eclipse
actions.aoe+=/call_action_list,name=pre_cd
actions.aoe+=/celestial_alignment,if=variable.cd_condition
actions.aoe+=/incarnation,if=variable.cd_condition
actions.aoe+=/warrior_of_elune,if=!talent.lunar_calling&buff.eclipse_solar.remains<7|talent.lunar_calling&!buff.dreamstate.up
actions.aoe+=/starfire,if=(!talent.lunar_calling&spell_targets.starfire=1)&(buff.eclipse_solar.up&buff.eclipse_solar.remains<action.starfire.cast_time|eclipse.in_none)
actions.aoe+=/starfall,if=buff.starweavers_warp.up|buff.touch_the_cosmos.up
actions.aoe+=/starsurge,if=buff.starweavers_weft.up
actions.aoe+=/starfall
actions.aoe+=/convoke_the_spirits,if=(!buff.dreamstate.up&!buff.umbral_embrace.up&spell_targets.starfire<7|spell_targets.starfire=1)&(fight_remains<5|(buff.ca_inc.up|cooldown.ca_inc.remains>40)&(!hero_tree.keeper_of_the_grove|buff.harmony_of_the_grove.up|cooldown.force_of_nature.remains>15))
actions.aoe+=/new_moon
actions.aoe+=/half_moon
actions.aoe+=/full_moon
actions.aoe+=/wild_mushroom,if=!prev_gcd.1.wild_mushroom&!dot.fungal_growth.ticking
actions.aoe+=/force_of_nature,if=!hero_tree.keeper_of_the_grove
actions.aoe+=/starfire,if=talent.lunar_calling|buff.eclipse_lunar.up&spell_targets.starfire>3-(talent.umbral_intensity|talent.soul_of_the_forest)
actions.aoe+=/wrath

actions.kotg_pre_cd=potion,if=buff.ca_inc.up
actions.kotg_pre_cd+=/use_items,if=buff.ca_inc.up|fight_remains<15
actions.kotg_pre_cd+=/fury_of_elune,if=!buff.ca_inc.up&(variable.kotg_single_ca_condition|variable.kotg_double_ca_condition)|cooldown.convoke_the_spirits.remains>cooldown.fury_of_elune.duration

actions.kotg_st=warrior_of_elune,if=variable.eclipse_remains<=7
actions.kotg_st+=/wait,if=!talent.incarnation_chosen_of_elune&buff.dryad.up&(buff.ca_inc.remains<(cooldown.ca_inc.remains>?gcd.max*2)|buff.dryad.remains<gcd.max&fight_remains>buff.dryad.remains&fight_remains<buff.dryad.remains+gcd.max|buff.dryad.remains<gcd.max&fight_remains>buff.dryad.remains+gcd.max&fight_remains<buff.dryad.remains+gcd.max*2),sec=buff.dryad.remains
actions.kotg_st+=/wrath,if=variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time|(variable.kotg_single_ca_condition|variable.kotg_double_ca_condition|variable.kotg_inc_condition)&buff.parting_skies.up&(variable.eclipse_remains<cast_time|eclipse.in_none)
actions.kotg_st+=/starfire,if=!variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time&!buff.dryads_favor.up&!(variable.kotg_single_ca_condition|variable.kotg_double_ca_condition|variable.kotg_second_ca_condition|variable.kotg_inc_condition)
actions.kotg_st+=/moonfire,target_if=(remains<(3>?fight_remains)&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up|variable.kotg_single_ca_condition))|!dot.moonfire.ticking
actions.kotg_st+=/sunfire,target_if=remains<(3>?fight_remains)|variable.kotg_single_ca_condition&remains<(buff.dryad.duration+2>?fight_remains)&(astral_power>=action.starsurge.cost*2-action.sunfire.energize_amount|fight_remains<buff.ca_inc.duration+gcd.max*2)|variable.kotg_double_ca_condition&!buff.harmony_of_the_grove.up&remains<(buff.harmony_of_the_grove.duration>?fight_remains)&(astral_power>=action.starsurge.cost*2-action.sunfire.energize_amount-action.force_of_nature.energize_amount*cooldown.force_of_nature.ready|fight_remains<buff.dryad.duration+2+4+gcd.max*5)&!buff.ca_inc.up
actions.kotg_st+=/call_action_list,name=kotg_pre_cd
actions.kotg_st+=/force_of_nature,if=variable.kotg_double_ca_condition&astral_power>=action.starsurge.cost*2-action.force_of_nature.energize_amount&!(buff.harmony_of_the_grove.duration<cooldown.ca_inc.full_recharge_time+gcd.max*2)
actions.kotg_st+=/celestial_alignment,if=variable.kotg_single_ca_condition&(astral_power>=action.starsurge.cost*2|fight_remains<buff.ca_inc.duration+gcd.max)
actions.kotg_st+=/celestial_alignment,if=variable.kotg_double_ca_condition&(astral_power>=action.starsurge.cost*2|fight_remains<buff.dryad.duration+2+4+gcd.max*3)
actions.kotg_st+=/force_of_nature,if=(buff.dryads_favor.up|cooldown.ca_inc.remains<gcd.max&fight_remains<buff.dryad.duration+2+gcd.max*2)&buff.ca_inc.up
actions.kotg_st+=/celestial_alignment,if=variable.kotg_second_ca_condition
actions.kotg_st+=/incarnation,if=variable.kotg_inc_condition
actions.kotg_st+=/starsurge,if=buff.dryads_favor.up&buff.ca_inc.up
actions.kotg_st+=/wrath,if=variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
actions.kotg_st+=/starfire,if=!variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
actions.kotg_st+=/stellar_flare,if=remains<=buff.ca_inc.duration&variable.pool_for_cd|remains<=buff.ca_inc.up&!buff.dryads_favor.up
actions.kotg_st+=/force_of_nature,if=buff.dryad.up&buff.harmony_of_the_grove.duration>(buff.dryad.remains+2>?cooldown.ca_inc.remains+gcd.max*2+0.5)
actions.kotg_st+=/force_of_nature,if=!buff.ca_inc.up&variable.boat_stacks>=8&fight_remains>=cooldown.convoke_the_spirits.duration+cooldown.convoke_the_spirits.remains+4+gcd.max&!((cooldown.force_of_nature.duration>cooldown.convoke_the_spirits.remains&fight_remains<(cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration-(cooldown.force_of_nature.duration+gcd.max*5)*talent.control_of_the_dream<?105)+cooldown.force_of_nature.duration+4+gcd.max*6)|(variable.on_use_trinket=1&fight_remains>trinket.1.cooldown.duration+trinket.1.cooldown.remains+4+buff.dryad.duration+2+gcd.max&cooldown.force_of_nature.duration>trinket.1.cooldown.remains&fight_remains<cooldown.force_of_nature.duration+trinket.1.cooldown.duration+4+buff.dryad.duration+2+gcd.max)|(variable.on_use_trinket=2&fight_remains>trinket.2.cooldown.duration+trinket.2.cooldown.remains+4+buff.dryad.duration+2+gcd.max&cooldown.force_of_nature.duration>trinket.2.cooldown.remains&fight_remains<cooldown.force_of_nature.duration+trinket.2.cooldown.duration+4+buff.dryad.duration+2+gcd.max))&!((cooldown.convoke_the_spirits.remains<?(variable.on_use_trinket=1)*trinket.1.cooldown.remains<?(variable.on_use_trinket=2)*trinket.2.cooldown.remains<?(variable.on_use_trinket=3)*(trinket.1.cooldown.remains>?trinket.2.cooldown.remains))<cooldown.force_of_nature.duration-(60-talent.early_spring*15)*0.5)
actions.kotg_st+=/force_of_nature,if=!buff.ca_inc.up&variable.boat_stacks>=8&fight_remains<cooldown.convoke_the_spirits.duration+cooldown.convoke_the_spirits.remains+4+gcd.max&!(fight_remains>cooldown.ca_inc.remains+buff.harmony_of_the_grove.duration*0.6+gcd.max&fight_remains<cooldown.force_of_nature.duration+buff.harmony_of_the_grove.duration*0.6+gcd.max*2)&!(fight_remains>cooldown.ca_inc.full_recharge_time+buff.dryad.duration+2+gcd.max&fight_remains<cooldown.force_of_nature.duration+buff.dryad.duration+2+gcd.max*2)&!(fight_remains<cooldown.force_of_nature.duration+gcd.max*2)
actions.kotg_st+=/force_of_nature,if=fight_remains<buff.harmony_of_the_grove.duration+gcd.max
actions.kotg_st+=/starsurge,if=buff.dryad.remains>buff.dryad.duration-gcd.max-0.3
actions.kotg_st+=/wrath,if=variable.pool_for_cd
actions.kotg_st+=/fury_of_elune,if=5+variable.passive_asp<astral_power.deficit&(cooldown.convoke_the_spirits.remains>buff.fury_of_elune.duration|!talent.convoke_the_spirits)|fight_remains<8+gcd.max
actions.kotg_st+=/starfall,if=buff.starweavers_warp.up
actions.kotg_st+=/starsurge,if=talent.starlord&buff.starlord.stack<3&!variable.pool_in_ca&!(variable.convoke_condition&cooldown.convoke_the_spirits.ready)
actions.kotg_st+=/sunfire,target_if=refreshable&remains<fight_remains
actions.kotg_st+=/moonfire,target_if=refreshable&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)&remains<fight_remains
actions.kotg_st+=/starsurge,if=cooldown.convoke_the_spirits.remains<gcd.max*2&variable.convoke_condition&!(cooldown.ca_inc.remains<buff.dryad.remains&(buff.dryad.remains<4+gcd.max|fight_remains>cooldown.ca_inc.remains+buff.dryad.duration+2&fight_remains<4+buff.dryad.duration+2+gcd.max))&!(buff.harmony_of_the_grove.remains<4+gcd.max)&!(cooldown.ca_inc.remains<buff.harmony_of_the_grove.remains-gcd.max&buff.harmony_of_the_grove.remains<4+gcd.max*2)&!(fight_remains<4+gcd.max)&!(buff.ca_inc.remains<4+gcd.max)
actions.kotg_st+=/convoke_the_spirits,if=variable.convoke_condition&!(cooldown.ca_inc.remains<buff.dryad.remains&(buff.dryad.remains<4|fight_remains>cooldown.ca_inc.remains+buff.dryad.duration+2&fight_remains<4+buff.dryad.duration+2))
actions.kotg_st+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-target>7+spell_targets)&!buff.ca_inc.up
actions.kotg_st+=/starsurge,if=(buff.starlord.remains>4&variable.boat_stacks>=7|fight_remains<4)&!variable.pool_in_ca
actions.kotg_st+=/new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&((buff.harmony_of_the_grove.up&!buff.ca_inc.up|buff.ca_inc.up&!cooldown.ca_inc.ready)|cooldown.new_moon.full_recharge_time<cooldown.convoke_the_spirits.remains)|fight_remains<20
actions.kotg_st+=/half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&((buff.harmony_of_the_grove.up&!buff.ca_inc.up|buff.ca_inc.up&!cooldown.ca_inc.ready)|cooldown.new_moon.full_recharge_time<cooldown.convoke_the_spirits.remains)|fight_remains<20
actions.kotg_st+=/full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&((buff.harmony_of_the_grove.up&!buff.ca_inc.up|buff.ca_inc.up&!cooldown.ca_inc.ready)|cooldown.new_moon.full_recharge_time<cooldown.convoke_the_spirits.remains)|fight_remains<20
actions.kotg_st+=/starsurge,if=buff.starweavers_weft.up|buff.touch_the_cosmos.up
actions.kotg_st+=/starsurge,if=(astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*2)))&!variable.pool_in_ca
actions.kotg_st+=/wild_mushroom,if=!prev_gcd.1.wild_mushroom&dot.fungal_growth.remains<2
actions.kotg_st+=/wrath

actions.pre_cd=use_item,name=spymasters_web,if=variable.cd_condition&(buff.spymasters_report.stack>29|fight_remains<cooldown.ca_inc.duration)
actions.pre_cd+=/do_treacherous_transmitter_task,if=variable.cd_condition|buff.harmony_of_the_grove.up&(buff.spymasters_report.stack>29|!trinket.1.is.spymasters_web|!trinket.2.is.spymasters_web)
actions.pre_cd+=/berserking,if=variable.cd_condition
actions.pre_cd+=/potion,if=variable.cd_condition
actions.pre_cd+=/use_item,slot=trinket1,if=!trinket.1.is.spymasters_web&!trinket.1.is.imperfect_ascendancy_serum&!trinket.1.is.treacherous_transmitter&!trinket.1.is.soulletting_ruby&(variable.on_use_trinket=1|variable.on_use_trinket=3)&variable.cd_condition
actions.pre_cd+=/use_item,slot=trinket2,if=!trinket.2.is.spymasters_web&!trinket.2.is.imperfect_ascendancy_serum&!trinket.2.is.treacherous_transmitter&!trinket.2.is.soulletting_ruby&variable.on_use_trinket=2&variable.cd_condition
actions.pre_cd+=/use_item,name=bestinslots,if=hero_tree.keeper_of_the_grove&buff.harmony_of_the_grove.up|hero_tree.elunes_chosen&(cooldown.ca_inc.full_recharge_time>20|buff.ca_inc.up)

actions.st=warrior_of_elune,if=talent.lunar_calling&!buff.dreamstate.up&(buff.ca_inc.up|cooldown.ca_inc.remains>10|fight_remains<cooldown.ca_inc.remains+5)|!talent.lunar_calling&variable.eclipse_remains<=7
actions.st+=/fury_of_elune,if=(cooldown.ca_inc.remains<?variable.eclipse_remains)<gcd.max|cooldown.ca_inc.remains<fight_remains&fight_remains<(buff.ca_inc.duration+gcd.max>?fight_remains-cooldown.ca_inc.remains)+gcd.max|fight_remains<8+gcd.max
actions.st+=/wrath,if=variable.enter_lunar&eclipse.in_eclipse&variable.eclipse_remains<cast_time&!(cooldown.ca_inc.remains<action.starfire.cast_time)
actions.st+=/starfire,if=(!variable.enter_lunar|cooldown.ca_inc.remains<cast_time)&eclipse.in_eclipse&variable.eclipse_remains<cast_time
actions.st+=/sunfire,target_if=remains<3|refreshable&(hero_tree.keeper_of_the_grove&cooldown.force_of_nature.ready|hero_tree.elunes_chosen&variable.cd_condition)
actions.st+=/moonfire,target_if=remains<3&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)
actions.st+=/fury_of_elune,if=5+variable.passive_asp<astral_power.deficit&(!(cooldown.ca_inc.remains<variable.eclipse_remains&variable.eclipse_remains<12)|buff.dreamstate.up&cooldown.ca_inc.remains<gcd.max)
actions.st+=/call_action_list,name=pre_cd
actions.st+=/celestial_alignment,if=variable.cd_condition
actions.st+=/incarnation,if=variable.cd_condition&(buff.dreamstate.stack=2|prev_gcd.1.fury_of_elune&buff.dreamstate.up|fight_remains<buff.ca_inc.duration+gcd.max)
actions.st+=/wrath,if=variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
actions.st+=/starfire,if=!variable.enter_lunar&(eclipse.in_none|variable.eclipse_remains<cast_time)
actions.st+=/starsurge,if=variable.cd_condition&astral_power.deficit>variable.passive_asp+action.force_of_nature.energize_amount
actions.st+=/force_of_nature,if=variable.pre_cd_condition|cooldown.ca_inc.full_recharge_time+5+15*talent.control_of_the_dream>cooldown&(!talent.convoke_the_spirits|cooldown.convoke_the_spirits.remains+10+15*talent.control_of_the_dream>cooldown|fight_remains<cooldown.convoke_the_spirits.remains+cooldown.convoke_the_spirits.duration+5)&(variable.on_use_trinket=0|cooldown.ca_inc.remains>20|talent.convoke_the_spirits&cooldown.convoke_the_spirits.remains>20|(variable.on_use_trinket=1|variable.on_use_trinket=3)&(trinket.1.cooldown.remains>5+15*talent.control_of_the_dream|trinket.1.cooldown.ready)|variable.on_use_trinket=2&(trinket.2.cooldown.remains>5+15*talent.control_of_the_dream|trinket.2.cooldown.ready))&(fight_remains>cooldown+5|fight_remains<cooldown.ca_inc.remains+7)|talent.whirling_stars&talent.convoke_the_spirits&cooldown.convoke_the_spirits.remains>cooldown.force_of_nature.duration-10&fight_remains>cooldown.convoke_the_spirits.remains+6
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/starsurge,if=talent.starlord&buff.starlord.stack<3
actions.st+=/sunfire,target_if=refreshable
actions.st+=/moonfire,target_if=refreshable&(!talent.treants_of_the_moon|cooldown.force_of_nature.remains>3&!buff.harmony_of_the_grove.up)
actions.st+=/starsurge,if=cooldown.convoke_the_spirits.remains<gcd.max*2&variable.convoke_condition&astral_power.deficit<50
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-target>7+spell_targets)
actions.st+=/starsurge,if=buff.starlord.remains>4&variable.boat_stacks>=3|fight_remains<4
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+energize_amount|fight_remains<20|cooldown.ca_inc.remains>15
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)|fight_remains<20|cooldown.ca_inc.remains>15
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+energize_amount&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)|fight_remains<20|cooldown.ca_inc.remains>15
actions.st+=/starsurge,if=buff.starweavers_weft.up|buff.touch_the_cosmos.up
actions.st+=/starsurge,if=astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max+action.starfire.cast_time))
actions.st+=/force_of_nature,if=!hero_tree.keeper_of_the_grove
actions.st+=/wild_mushroom,if=!prev_gcd.1.wild_mushroom&dot.fungal_growth.remains<2
actions.st+=/starfire,if=talent.lunar_calling
actions.st+=/wrath

head=skymane_of_the_mother_eagle,id=237682,bonus_id=12352/10355/12231/6652/12921/12676/1511/10255
neck=gobfathers_gifted_bling,id=228842,bonus_id=6652/10355/10879/10396/11990/1514/10255,gems=147mastery_49haste_147mastery_49haste
shoulders=ritual_pauldrons_of_the_mother_eagle,id=237680,bonus_id=12233/10390/6652/12675/12355/1520/10255
back=reshii_wraps,id=235499,bonus_id=12401/9893,gem_id=238039/0/0/0,enchant=chant_of_winged_grace_3
chest=vest_of_the_mother_eagle,id=237685,bonus_id=6652/10390/12229/12676/12355/1520/10255,enchant=crystalline_radiance_3
shirt=preciouss_ribbon,id=52019
wrists=bindings_of_lost_essence,id=237546,bonus_id=6652/12921/12239/10354/12293/1501/10255
hands=wings_of_the_mother_eagle,id=237683,bonus_id=12353/10355/12230/42/12675/1514/10255
waist=durable_information_securing_container,id=245964,bonus_id=12533/1489,gems=147mastery_49haste
legs=breeches_of_the_mother_eagle,id=237681,bonus_id=6652/10390/12232/12676/12355/1520/10255,enchant=sunset_spellthread_3
feet=umbral_stalkers_footpads,id=243041,bonus_id=6652/12239/10354/12292/1498/10255,enchant=defenders_march_3
finger1=whispers_of_karesh,id=242491,bonus_id=12351/10390/6652/10395/10878/10383/3189/10255,gems=147mastery_49haste,enchant=cursed_haste_3
finger2=the_jastor_diamond,id=231265,bonus_id=6652/10395/10392/10354/11984/1507/10255,enchant=cursed_haste_3
trinket1=azhiccaran_parapodia,id=242497,bonus_id=12353/10390/6652/10383/3196/10255
trinket2=astral_antenna,id=242395,bonus_id=6652/10355/12351/1507/10255
main_hand=staff_of_fractured_spacetime,id=185822,bonus_id=10390/6652/10384/12352/10013/10255,enchant=authority_of_the_depths_3

# Gear Summary
# gear_ilvl=697.80
# gear_stamina=518078
# gear_intellect=88136
# gear_crit_rating=4303
# gear_haste_rating=17307
# gear_mastery_rating=23474
# gear_versatility_rating=388
# gear_speed_rating=842
# gear_avoidance_rating=545
# gear_armor=37998
# set_bonus=name=thewarwithin_season_3,pc=2,hero_tree=elunes_chosen,enable=1
# set_bonus=name=thewarwithin_season_3,pc=4,hero_tree=elunes_chosen,enable=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 72273770
Max Event Queue: 105
Sim Seconds: 3007018
CPU Seconds: 106.9165
Physical Seconds: 17.5601
Speed Up: 28125

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health3,676,061.90.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Trigger CountInterval
Dynamic Buffs Start Refresh Total Start Trigger Duration Uptime Benefit Overflow Expiry
Atmospheric Exposure12.0738.2750.225.5s0.4s21.6s86.27%0.00%738.2 (738.2)11.1

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_atmospheric_exposure
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 162.0s
  • trigger_min/max:0.0s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.1s
  • uptime_min/max:77.79% / 95.78%

Stack Uptimes

  • atmospheric_exposure_1:86.27%

Spelldata

  • id:430589
  • name:Atmospheric Exposure
  • tooltip:Damage taken from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc429532=Enemies damaged by {$?a137013=true}[Full Moon or Fury of Elune][Lunar Beam or Fury of Elune] take {$430589s1=6}% increased damage from you for {$430589d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:429532
  • name:Atmospheric Exposure
  • tooltip:
  • description:Enemies damaged by {$?a137013=true}[Full Moon or Fury of Elune][Lunar Beam or Fury of Elune] take {$430589s1=6}% increased damage from you for {$430589d=6 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Waning Twilight5.90.05.952.0s52.1s46.9s91.71%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêphôr
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 310.1s
  • trigger_min/max:6.0s / 310.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.7s
  • uptime_min/max:67.24% / 99.71%

Stack Uptimes

  • waning_twilight_1:91.71%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=6}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3790192.48
Minimum 3317487.52
Maximum 4376395.58
Spread ( max - min ) 1058908.06
Range [ ( max - min ) / 2 * 100% ] 13.97%
Standard Deviation 145197.8153
5th Percentile 3557111.52
95th Percentile 4035978.27
( 95th Percentile - 5th Percentile ) 478866.75
Mean Distribution
Standard Deviation 1452.0508
95.00% Confidence Interval ( 3787346.52 - 3793038.45 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5638
0.1 Scale Factor Error with Delta=300 179971540
0.05 Scale Factor Error with Delta=300 719886159
0.01 Scale Factor Error with Delta=300 17997153967
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health09182693900
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Total Time

Time spent on executing the ability. Includes cast times, gcd times, and channel times.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.